DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and Cacnb3

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_017171904.1 Gene:Cacnb3 MGIID:103307 Length:490 Species:Mus musculus

Alignment Length:546 Identity:278/547 (51%)
Similarity:343/547 (63%) Gaps:102/547 (19%)


  Fly    29 SYQSGYNKLFTQGSADSNYSQPS--SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNV 91
            ||..|:.. ...|||||..|:||  ||:||:|::||.|||.|.||..||::|:.|||||||||||
Mouse     5 SYVPGFED-SEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPVAFAVRTNV 68

  Fly    92 AYDGAIDDDSPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQT 156
            :|.|.:|::.||||..|:||.::||||||||.|:||||||||||.|:.|||||.:|::||::.:.
Mouse    69 SYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPSPQRLESIRLKQEQ 133

  Fly   157 RPSRLYGTKGSSSGNLGAGGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFK 221
            :..|        |||..:.|..|   :|.|.||                    :..|:|:    |
Mouse   134 KARR--------SGNPSSLGDIG---NRRSPPP--------------------SLAKQKQ----K 163

  Fly   222 KQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSI 286
            :.|...|||||||||||||||||||||||||||||||||||||||:|||.||||.||:||||||:
Mouse   164 QAEHVPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSV 228

  Fly   287 MNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYL 351
            :|||.||.|:||||:||. :.:||.|||||||||:||||||||.||||||:|||||||||.||::
Mouse   229 LNNPGKRTIIERSSARSS-IAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFV 292

  Fly   352 KISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYW 416
            |:||.|||||||:||||||.|:|:|||:|.:||.||||:.||||||||||||||||:|||||.||
Mouse   293 KVSSPKVLQRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYW 357

  Fly   417 KATHPDIRAVPPIARPLPQEASPSADPARLGPTPPVDG-------------EEFVDEQDP--RMG 466
            :|||                 .|:..|..|||...:.|             .|.|:|..|  |..
Mouse   358 RATH-----------------HPAPGPGLLGPPSAIPGLQILCGPQNQQLLGERVEEHSPLERDS 405

  Fly   467 MSGGDR--EGSRERDRDSRERERERERERDYWDR-----EFNRDRSS----------------KD 508
            :...|.  |.||:....|.:|. .|..|.||.|.     :.:|..:|                :|
Mouse   406 LMPSDEASESSRQAWTGSSQRS-SRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQD 469

  Fly   509 RERDLEWERERAREWERERERDWDRE 534
            .|.|     ...|.|  :|.|.|.::
Mouse   470 SEHD-----HNDRNW--QRNRPWPKD 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 24/42 (57%)
SH3_CACNB 85..146 CDD:212797 42/61 (69%)
Guanylate_kin 234..415 CDD:279019 145/181 (80%)
NK 244..416 CDD:302627 136/172 (79%)
Cacnb3XP_017171904.1 VGCC_beta4Aa_N 16..58 CDD:288872 24/42 (57%)
SH3_CACNB3 58..125 CDD:212975 47/67 (70%)
Guanylate_kin 176..356 CDD:279019 145/181 (80%)
NK 186..357 CDD:302627 136/172 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52548524
eggNOG 1 0.900 E1_KOG3812
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 1 1.000 T615441
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11824
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.800

Return to query results.
Submit another query.