DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and Cacnb2

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_075605.1 Gene:Cacnb2 MGIID:894644 Length:655 Species:Mus musculus

Alignment Length:630 Identity:324/631 (51%)
Similarity:392/631 (62%) Gaps:117/631 (19%)


  Fly     5 ASSSDAPSVQGGQHRESRF--GLGYPSYQSGYNKLFTQGSADSNYSQPS-SDLSLDEEKESLRRE 66
            |.:..|.|...|..|::||  ..|..|..:..|....||||||..|:|| ||:||:|::|::|||
Mouse    30 AGALGAQSYGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRRE 94

  Fly    67 KERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKEKYDNNWWIGRL 131
            .||||.:||:||::|||||||||||.|..|.:||.||.|.|:|||.::|||:|||::|:||||||
Mouse    95 AERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRL 159

  Fly   132 VKEGCDVGFIPSPAKLDNIRMQNQTR--PSRLYGTK--GSSSGNLGAGGQAGAEP-SRGSTPPTP 191
            |||||::||||||.||:|:|:|::.|  ..:.|.:|  |:||.:||     ...| ||.||||:.
Mouse   160 VKEGCEIGFIPSPVKLENMRLQHEQRAKQGKFYSSKSGGNSSSSLG-----DIVPSSRKSTPPSS 219

  Fly   192 GDESDSMG--------PGRHGKTPAAAAN-------KEKRKPFFKKQETASPYDVVPSMRPVVLV 241
            ..:.|:.|        |..| ::|..:||       ||||.|||||.|...||||||||||||||
Mouse   220 AIDIDATGLDAEENDIPANH-RSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLV 283

  Fly   242 GPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCL 306
            |||||||||||||||||||||||||||||.||||.|||||||||::|||||.||:|||::||. |
Mouse   284 GPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSS-L 347

  Fly   307 GKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQA 371
            .:||.||||||||||:|||||||.||||||:||:||||||.|||:||||.|||||||||||||||
Mouse   348 AEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQA 412

  Fly   372 KNLSVQMVAAEKLAQCPP-DMFDVILDENQLEDACEHIAEYLETYWKATHPDIRAVP-------- 427
            |:|:||||||:||||||| :.||||||||||||||||:|:|||.|||||||....:|        
Mouse   413 KHLNVQMVAADKLAQCPPQESFDVILDENQLEDACEHLADYLEAYWKATHPPSGNLPNPLLSRTL 477

  Fly   428 -----PIARPLPQEASPSAD---PARLGPTPPVDGEE---------------FVDEQDPRMGMSG 469
                 |::..|...:..|..   |.|..|......||               ....|:.|.|...
Mouse   478 ASSTLPLSPTLASNSQGSQGDQRPDRSAPRSASQAEEEPCLEPVKKSQHRSSSATHQNHRSGTGR 542

  Fly   470 G-------DREGSRERD--------------------------------------RDSRERERER 489
            |       |.|....||                                      |:||.|.|:.
Mouse   543 GLSRQETFDSETQESRDSAYVEPKEDYSHEHVDRYVPHREHNHREETHSSNGHRHRESRHRSRDM 607

  Fly   490 ERERDYWDREFNRDRS---SKDRERDLEWE-----RERAREWERE 526
            .|::|:  .|..:.||   ||||..|.|.|     |..|.||.|:
Mouse   608 GRDQDH--NECIKQRSRHKSKDRYCDKEGEVISKRRNEAGEWNRD 650

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 25/41 (61%)
SH3_CACNB 85..146 CDD:212797 42/61 (69%)
Guanylate_kin 234..415 CDD:279019 153/182 (84%)
NK 244..416 CDD:302627 144/173 (83%)
Cacnb2NP_075605.1 VGCC_beta4Aa_N 68..109 CDD:288872 25/41 (61%)
SH3_CACNB2 108..176 CDD:212973 48/68 (71%)
Guanylate_kin 276..457 CDD:279019 153/182 (84%)
NK 286..458 CDD:302627 144/173 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52539313
eggNOG 1 0.900 E1_KOG3812
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 511 1.000 Inparanoid score I1297
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 1 1.000 T615441
orthoMCL 1 0.900 OOG5_128949
Panther 1 1.100 O PTHR11824
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3437
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.