DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and Cacnb1

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_006532154.1 Gene:Cacnb1 MGIID:102522 Length:654 Species:Mus musculus

Alignment Length:639 Identity:319/640 (50%)
Similarity:398/640 (62%) Gaps:96/640 (15%)


  Fly    11 PSVQ----GGQH--RESRF--GLGYPSYQSGYNKLFTQGSADSNYSQPS-SDLSLDEEKESLRRE 66
            |.||    ||::  |:.||  ..|..|..:..|....||||:|..|:|| ||:||:|::|:||:|
Mouse    32 PRVQVPAAGGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDSDVSLEEDREALRKE 96

  Fly    67 KERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKEKYDNNWWIGRL 131
            .|||||:||:||::|||||||||||.|:.:..|:.||||.|::||.::||||||||:|:||||||
Mouse    97 AERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVQGVAITFEPKDFLHIKEKYNNDWWIGRL 161

  Fly   132 VKEGCDVGFIPSPAKLDNIR-MQNQT-RPSRLYGTK-----GSSSGNLGAGGQAGAEPSRGSTPP 189
            |||||:|||||||.|||::| :|.|| |.:||..:|     .||.|::..|       :|..|||
Mouse   162 VKEGCEVGFIPSPVKLDSLRLLQEQTLRQNRLSSSKSGDNSSSSLGDVVTG-------TRRPTPP 219

  Fly   190 TPGDESDS----MGP----------GRHG---KTPAAAANKE----KRKPFFKKQETASPYDVVP 233
            ..|:|..:    :.|          |.||   ||..::....    ||.|||||.|...||||||
Mouse   220 ASGNEMTNFAFELDPLELEEEEAELGEHGGSAKTSVSSVTTPPPHGKRIPFFKKTEHVPPYDVVP 284

  Fly   234 SMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMER 298
            ||||::|||||||||||||||||||||||||||:|||.||||.|||||||||::|||||..|:||
Mouse   285 SMRPIILVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIER 349

  Fly   299 SSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLI 363
            |::||. |.:||.||||||||||:||||.||.||||||:||:||||||.|||:||:|.|||||||
Mouse   350 SNTRSS-LAEVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLI 413

  Fly   364 KSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATHPDIRAVP- 427
            |||||||:|:|:||:.|:||||||||:|||:|||||||||||||:|||||.|||||||.....| 
Mouse   414 KSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPPN 478

  Fly   428 PIARPLPQEASPSADPARL----GP-----TPPVD---GEE-FVDEQDPRMGMSGGDREGSRERD 479
            |:.......|:.:|.||.:    ||     ..|:|   ||. .|.|....:|...|....:....
Mouse   479 PLLNRTMATAALAASPAPVSNLQGPYLASGDQPLDRATGEHASVHEYPGELGQPPGLYPSNHPPG 543

  Fly   480 RDSRERERERERERDYWDREFNRDRSSKDRER-----DLEWERER--------------AREWER 525
            |....|...|:   |.:|.:....|:|...|.     |:|.:...              ||:...
Mouse   544 RAGTLRALSRQ---DTFDADTPGSRNSAYTEPGDSCVDMETDPSEGPGPGDPAGGGTPPARQGSW 605

  Fly   526 ERERDWDREFDWDQGGTSYQHSRRQPTSVRHQERGGGVGAG-------GGGGGV 572
            |.|.|::.|..        .:..|.....|:...|||...|       |.|.||
Mouse   606 EDEEDYEEEMT--------DNRNRGRNKARYCAEGGGPVLGRNKNELEGWGQGV 651

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 25/41 (61%)
SH3_CACNB 85..146 CDD:212797 43/61 (70%)
Guanylate_kin 234..415 CDD:279019 145/181 (80%)
NK 244..416 CDD:302627 138/172 (80%)
Cacnb1XP_006532154.1 VGCC_beta4Aa_N 70..111 CDD:288872 25/41 (61%)
SH3_CACNB1 111..178 CDD:212974 49/67 (73%)
Guanylate_kin 285..465 CDD:279019 145/181 (80%)
GuKc 295..466 CDD:214504 138/172 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52537989
eggNOG 1 0.900 E1_KOG3812
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 511 1.000 Inparanoid score I1297
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 1 1.000 T615441
orthoMCL 1 0.900 OOG5_128949
Panther 1 1.100 LDO PTHR11824
Phylome 1 0.910 0.778 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3437
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.