DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and Cacnb2

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_017455922.1 Gene:Cacnb2 RGDID:67385 Length:641 Species:Rattus norvegicus

Alignment Length:618 Identity:315/619 (51%)
Similarity:397/619 (64%) Gaps:79/619 (13%)


  Fly    35 NKLFTQGSADSNYSQPS-SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAID 98
            :|..:.|||||..|:|| ||:||:|::|::|||.||||.:||:||::|||||||||||.|..|.:
  Rat    48 SKNVSWGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQE 112

  Fly    99 DDSPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTR--PSRL 161
            ||.||.|.|:|||.::|||:|||::|:|||||||||||::||||||.||:|:|:|::.|  ..:.
  Rat   113 DDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKQGKF 177

  Fly   162 YGTK--GSSSGNLGAGGQAGAEP-SRGSTPPTPGDESDSMG--------PGRHGKTPAAAAN--- 212
            |.:|  |:||.:||     ...| ||.||||:...:.|:.|        |..| ::|..:||   
  Rat   178 YSSKSGGNSSSSLG-----DIVPSSRKSTPPSSAIDIDATGLDAEENDIPANH-RSPKPSANSVT 236

  Fly   213 ----KEKRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIIT 273
                ||||.|||||.|...|||||||||||||||||||||||||||||||||||||||||||.||
  Rat   237 SPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISIT 301

  Fly   274 RVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQ 338
            ||.|||||||||::|||||.||:|||::||. |.:||.||||||||||:|||||||.||||||:|
  Rat   302 RVTADISLAKRSVLNNPSKHAIIERSNTRSS-LAEVQSEIERIFELARTLQLVVLDADTINHPAQ 365

  Fly   339 LAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPP-DMFDVILDENQLE 402
            |:||||||.|||:||||.||||||||||||||||:|:||||||:||||||| :.|||||||||||
  Rat   366 LSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPQESFDVILDENQLE 430

  Fly   403 DACEHIAEYLETYWKATHPDIRAVPP--IARPLPQEASPSADPARLGPTPPVDGEEFVDEQDPRM 465
            |||||:|:|||.|||||||....:|.  ::|.|.....| ..|.....:....|::..|...|| 
  Rat   431 DACEHLADYLEAYWKATHPPSSNLPNPLLSRTLATSTLP-LSPTLASNSQGSQGDQRTDRSAPR- 493

  Fly   466 GMSGGDREGSRERDRDSRERERERERE------------RDYWDREFNRDRSSKDRERDLEWERE 518
            ..|..:.|...|..:.|:.|......:            ::.:|.|....|.|...|...::..|
  Rat   494 SASQAEEEPCLEPVKKSQHRSSSATHQNHRSGTGRGLSRQETFDSETQESRDSAYVEPKEDYSHE 558

  Fly   519 RAREWERERERDWDREFDWDQGGTSYQHSRRQPTSVRHQERGGGVGAGGGGGGVGGGYERD---- 579
            ....:...||.:...|.....|     |..|:|   ||:.|..|               ||    
  Rat   559 HVDRYVPHREHNHREESHSSNG-----HRHREP---RHRTRDMG---------------RDQDHN 600

  Fly   580 ---RERERYERRERDLMHYDLNSDELLDERNFE 609
               ::|.|::.::|    |.....|::.:|..|
  Rat   601 ECSKQRSRHKSKDR----YCDKEGEVISKRRSE 629

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 25/41 (61%)
SH3_CACNB 85..146 CDD:212797 42/61 (69%)
Guanylate_kin 234..415 CDD:279019 153/182 (84%)
NK 244..416 CDD:302627 144/173 (83%)
Cacnb2XP_017455922.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52564728
eggNOG 1 0.900 E1_KOG3812
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 514 1.000 Inparanoid score I1228
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 1 1.000 T617551
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11824
Phylome 1 0.910 0.889 Consistency score
TreeFam 1 0.960
109.860

Return to query results.
Submit another query.