DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and cacnb2

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_017950282.1 Gene:cacnb2 XenbaseID:XB-GENE-962360 Length:615 Species:Xenopus tropicalis

Alignment Length:599 Identity:315/600 (53%)
Similarity:383/600 (64%) Gaps:121/600 (20%)


  Fly    41 GSADSNYSQPS-SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQ 104
            |||||..|:|| ||:||:|::|::|||.||||.:||:||::|||||||||||.|..|.||:.||.
 Frog    28 GSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVGYSAAHDDEVPVP 92

  Fly   105 GGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQ--TRPSRLYGTK-- 165
            |.|:|||.::|||:|||::|:|||||||||||::||||||.||:|:|:|::  |:..:.|.:|  
 Frog    93 GMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRIQHEQKTKQGKFYTSKSG 157

  Fly   166 GSSSGNLGAGGQAGAEP-SRGSTPPTPGDESDSMG---------PGRHGKTPAAAAN-------K 213
            |:||.:||     ...| ||.||||:...:.|:.|         |..| ::|..:||       |
 Frog   158 GNSSSSLG-----DVVPSSRRSTPPSSAIDLDATGLEAEELDIPPANH-RSPKPSANSLTSPHSK 216

  Fly   214 EKRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMAD 278
            |||.|||||.|...|||||||||||||||||||||||||||||||||||||||||||.||||.||
 Frog   217 EKRMPFFKKTEHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTAD 281

  Fly   279 ISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTS 343
            |||||||::|||||.||:|||::||. |.:||.||||||||||:|||||||.||||||:||.|||
 Frog   282 ISLAKRSVLNNPSKHAIIERSNTRSS-LAEVQSEIERIFELARTLQLVVLDADTINHPTQLGKTS 345

  Fly   344 LAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHI 408
            |||.|||:||||.||||||||||||||||:|:||||||:|||||||:|||||||||||||||||:
 Frog   346 LAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPEMFDVILDENQLEDACEHL 410

  Fly   409 AEYLETYWKATHPD---------IRAVPPIARPL-PQEASPS------------ADPARLGPTPP 451
            |:|||.|||||||.         .|.:.....|: |..||.:            :.|.|.|....
 Frog   411 ADYLEAYWKATHPPSSNPTNVLLSRTLTTATLPITPTSASNTQQSSQGDHQNQHSAPERTGSVEE 475

  Fly   452 VDGEEFVDEQDPRMG--------MSGGDREGSRE------------------------------- 477
            ....|...:...|..        .|||.|..||:                               
 Frog   476 DTSAEATKKSHHRSSSSAQHHNHRSGGSRGLSRQDTFDNETQANRDSVYLDPKEDFSSEHGAPPD 540

  Fly   478 -----------------RDRDSRERERERERERDYWDREFNRDRS---SKDR--ERDLEWERERA 520
                             |.::||.|..|.:||.|:  .|.|:.||   |:||  |:|.|..|:| 
 Frog   541 SHREHNHRDETHAVSEHRHKESRHRSNEPDREHDH--NECNKPRSRHKSRDRHCEKDGEVPRKR- 602

  Fly   521 REWERERERDWDRE 534
                  .|.||:|:
 Frog   603 ------NEADWNRD 610

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 25/41 (61%)
SH3_CACNB 85..146 CDD:212797 42/61 (69%)
Guanylate_kin 234..415 CDD:279019 154/181 (85%)
NK 244..416 CDD:302627 145/172 (84%)
cacnb2XP_017950282.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52588196
eggNOG 1 0.900 E1_KOG3812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.700

Return to query results.
Submit another query.