DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and cacnb4

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_012825641.1 Gene:cacnb4 XenbaseID:XB-GENE-1012455 Length:520 Species:Xenopus tropicalis

Alignment Length:548 Identity:285/549 (52%)
Similarity:358/549 (65%) Gaps:83/549 (15%)


  Fly    37 LFTQGSADSNYSQPS-SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDD 100
            :..||||||..|:|| ||:||:|::|::|:|:|:||..||::|::|||||||||||:|.||:|:|
 Frog    46 ILRQGSADSYTSRPSDSDVSLEEDREAIRQEREQQAAVQLERAKTKPVAFAVRTNVSYCGALDED 110

  Fly   101 SPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTK 165
            .||.|.|:||:.::||||||||:|:|||||||||||::||||||.:||.||:|.:.:..|.:|.|
 Frog   111 VPVPGTAISFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPQRLDYIRVQQEQKRGRTHGGK 175

  Fly   166 --GSSSGNLGAGGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKKQETASP 228
              |:||.:||       |...|:...||               |:||..|:      |..|...|
 Frog   176 SSGNSSSSLG-------EMVSGTFRATP---------------PSAAKQKQ------KVTELVPP 212

  Fly   229 YDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKR 293
            ||||||||||||||||||||||||||||||||||||||:|||.||||.|||||||||::|||||:
 Frog   213 YDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKK 277

  Fly   294 AIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKV 358
            .|:|||::||. |.:||.|||||||||||||||:||.||||||:||.||||||.||::|:||.||
 Frog   278 MIIERSNTRSS-LAEVQSEIERIFELARSLQLVILDADTINHPAQLIKTSLAPIIVHVKVSSPKV 341

  Fly   359 LQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATHPDI 423
            ||||||||||||:|:|:||:|||:|||||||:|||||||||||||||||:|||||.||:|||...
 Frog   342 LQRLIKSRGKSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLAEYLEAYWRATHTTS 406

  Fly   424 RA--VPPIARPLPQEASPSADPARLGPTPPVDGEEFVDEQDPRMGMSGGDREGSRERDRDSRERE 486
            ..  .|.:.|.|...|..|.      ||                .:||...:..|..:..:....
 Frog   407 TTPMTPLLGRNLGSTALTSY------PT----------------AISGLQSQRMRHSNHSTENSP 449

  Fly   487 RERERERDYWDREFNRDRSSKDRERDLEWERERAREWERERERDWDREFDWDQGGTSYQHSRRQP 551
            .|| |.....|..::.:|:.|.|.|     ...:.:..|:.....:.||     ..|||.:.:. 
 Frog   450 IER-RSLMTSDENYHNERARKSRNR-----LSSSSQHSRDHYPLVEEEF-----SDSYQDTYKP- 502

  Fly   552 TSVRHQERGGGVGAGGGGGGVGGGYERD 579
                |:.||.           .|||..|
 Frog   503 ----HRNRGS-----------PGGYSHD 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 22/41 (54%)
SH3_CACNB 85..146 CDD:212797 44/61 (72%)
Guanylate_kin 234..415 CDD:279019 149/181 (82%)
NK 244..416 CDD:302627 140/172 (81%)
cacnb4XP_012825641.1 VGCC_beta4Aa_N 50..91 CDD:288872 22/41 (54%)
SH3_CACNB4 91..158 CDD:212976 49/67 (73%)
Guanylate_kin 218..398 CDD:279019 149/181 (82%)
NK 228..399 CDD:302627 140/172 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52545880
eggNOG 1 0.900 E1_KOG3812
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H20188
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.