DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and cacnb1

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_012826986.1 Gene:cacnb1 XenbaseID:XB-GENE-995022 Length:628 Species:Xenopus tropicalis

Alignment Length:590 Identity:311/591 (53%)
Similarity:383/591 (65%) Gaps:70/591 (12%)


  Fly    19 RESRF--GLGYPSYQSGYNKLFTQGSADSNYSQPS-SDLSLDEEKESLRREKERQALSQLDKARS 80
            |:|||  ..|..|..:..|....||||:|..|:|| ||:||:|::|:||:|.||.||:||:||::
 Frog    35 RKSRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDSDVSLEEDREALRKEAERHALAQLEKAKT 99

  Fly    81 KPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPA 145
            |||||||||||.|..:..||:||||..::|:.::||||||||:|:|||||.|:|||:|||||||.
 Frog   100 KPVAFAVRTNVGYSPSPGDDAPVQGMCINFDPKDFLHIKEKYNNDWWIGRAVREGCEVGFIPSPV 164

  Fly   146 KLDNIRM--QNQTRPSRLYGTKGSSSGNLGAGGQAG--AEPSRGSTPPTPG----------DESD 196
            ||:::|:  :.:.|.|||     |||.::|.....|  ...:|..|||..|          |..|
 Frog   165 KLEHMRLLQEQKMRQSRL-----SSSKSIGNSNSLGDVVSGTRRPTPPATGPLESPLVYDIDHVD 224

  Fly   197 SMGPGRHGKTPAAAANKE---------------KRKPFFKKQETASPYDVVPSMRPVVLVGPSLK 246
            .    .:.:|.|.||.:.               ||.|||||.|...||||||||||::|||||||
 Frog   225 L----EYEETEAQAAQRSPLNSTGSVTTPPSTTKRVPFFKKTEHIPPYDVVPSMRPIILVGPSLK 285

  Fly   247 GYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQE 311
            ||||||||||||||||||||:|||.||||.|||||||||::|||||..|||||::||. |.:||.
 Frog   286 GYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHNIMERSNTRSS-LAEVQS 349

  Fly   312 EIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSV 376
            ||||||||||:||||.||.||||||:|||||||||.|||:||:|.|||.||||||||||||:|:|
 Frog   350 EIERIFELARTLQLVALDADTINHPAQLAKTSLAPIIVYIKITSPKVLHRLIKSRGKSQAKHLNV 414

  Fly   377 QMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATHPDIRAVPPIARPLP------- 434
            |||||:|||||||:|||:|||||||||||||:|||||.|||||||     |.|..|.|       
 Frog   415 QMVAADKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHP-----PSINPPNPLLNRTLA 474

  Fly   435 --QEASPSADPARLGPTPPVDGEEFVDEQDPRMGMSGGD----REGSRERDR-DSRERERERERE 492
              ..||..|..:.|..:..|.||...|..| :|||..|.    :.|||...| |:.|.|.:..|:
 Frog   475 TAALASSPAPVSNLQGSYLVHGELRPDGAD-QMGMYEGQLRRGQMGSRILSRHDTLESETQGSRD 538

  Fly   493 RDYWDREFNRDRSSKDRERDLEWERERAREWERERERDWDREFDWDQGGTSYQH--SRRQPTSVR 555
            ..|.:    ...|..|.|.| .:|....:....|..| ..|:..|::.|...::  .||:..|.|
 Frog   539 SAYTE----PGDSCMDIETD-PYEDPEPKSQGGETRR-LQRQGSWEELGPDQENLLQRRRRESPR 597

  Fly   556 HQERG 560
            .|.:|
 Frog   598 PQGKG 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 24/41 (59%)
SH3_CACNB 85..146 CDD:212797 40/61 (66%)
Guanylate_kin 234..415 CDD:279019 149/181 (82%)
NK 244..416 CDD:302627 142/172 (83%)
cacnb1XP_012826986.1 VGCC_beta4Aa_N 59..100 CDD:288872 24/41 (59%)
SH3_CACNB1 100..167 CDD:212974 46/67 (69%)
Guanylate_kin 273..453 CDD:279019 149/181 (82%)
NK 283..454 CDD:302627 142/172 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.