DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ca-beta and cacnb3

Sequence 1:NP_001260375.1 Gene:Ca-beta FlyBaseID:FBgn0259822 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_012811901.1 Gene:cacnb3 XenbaseID:XB-GENE-1011906 Length:485 Species:Xenopus tropicalis

Alignment Length:519 Identity:278/520 (53%)
Similarity:348/520 (67%) Gaps:76/520 (15%)


  Fly    41 GSADSNYSQPS--SDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPV 103
            |||||..|:||  ||:||:|::|:.|||.||||..||::||.|||||||||||:|.||:|::.||
 Frog    16 GSADSYTSRPSLDSDVSLEEDRETARREVERQAQEQLERARLKPVAFAVRTNVSYCGALDEECPV 80

  Fly   104 QGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSS 168
            ||.|::||.::||||||||:|:||:|||||||.|:.|||||.:|:.||::.:.:..|      |.
 Frog    81 QGAAINFEAKDFLHIKEKYNNDWWVGRLVKEGADITFIPSPQRLEAIRLKQEQKARR------SG 139

  Fly   169 SGNLGAGGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKKQETASPYDVVP 233
            .|::.:|       :|.|.||       ||.             |:|:    |:.|..:||||||
 Frog   140 GGDMVSG-------NRRSPPP-------SMA-------------KQKQ----KQAEHIAPYDVVP 173

  Fly   234 SMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMER 298
            |||||||||||||||||||||||||||||||||:|||.||||.||:||||||::|||.||||:||
 Frog   174 SMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRAIIER 238

  Fly   299 SSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLI 363
            ||:||. :.:||.|||||||||::||||:||.||||||:||:||||||.||::|:||.|||||||
 Frog   239 SSTRSS-IAEVQSEIERIFELAKTLQLVILDADTINHPTQLSKTSLAPIIVFVKVSSPKVLQRLI 302

  Fly   364 KSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATHPDIR---- 424
            |||||||.|:|:|||:||:||.||||::||||||||||||||||:|||:|.||:|||..:.    
 Frog   303 KSRGKSQVKHLNVQMLAADKLIQCPPELFDVILDENQLEDACEHLAEYMEVYWRATHHPLHPQNS 367

  Fly   425 ---AVPPIARPLPQEASPSADPARLGPTPPVDGEEFVDEQDPRMGMSGGDREGSRERDRDSRERE 486
               ..||.|.|..|:....:|.|         .|....|:|..| .|....|.||:....|.:|.
 Frog   368 QNLITPPTAIPGLQDQQLLSDRA---------NEHSPLERDSLM-QSDEASETSRKTWTASSQRS 422

  Fly   487 R---ERERERDYWD-----REFN------RDRSSKDR--ERDLEWERERAREWERERERDWDRE 534
            .   |.|....|.|     |..|      ....|:||  |||.| :....|.|  :|.|.|.::
 Frog   423 SHHLEDEYSDTYTDLYQPHRHHNSGLNSTNGHDSQDRLLERDSE-QNHNDRNW--QRNRPWPKD 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ca-betaNP_001260375.1 VGCC_beta4Aa_N 41..81 CDD:288872 25/42 (60%)
SH3_CACNB 85..146 CDD:212797 42/61 (69%)
Guanylate_kin 234..415 CDD:279019 144/181 (80%)
NK 244..416 CDD:302627 135/172 (78%)
cacnb3XP_012811901.1 VGCC_beta4Aa_N 16..58 CDD:288872 25/42 (60%)
SH3_CACNB3 58..125 CDD:212975 47/67 (70%)
Guanylate_kin 174..354 CDD:279019 144/181 (80%)
NK 184..355 CDD:302627 135/172 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52550055
eggNOG 1 0.900 E1_KOG3812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000450
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.700

Return to query results.
Submit another query.