DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup160 and NUP120

Sequence 1:NP_001285832.1 Gene:Nup160 FlyBaseID:FBgn0262647 Length:1411 Species:Drosophila melanogaster
Sequence 2:NP_012866.1 Gene:NUP120 SGDID:S000001540 Length:1037 Species:Saccharomyces cerevisiae

Alignment Length:1123 Identity:222/1124 (20%)
Similarity:404/1124 (36%) Gaps:311/1124 (28%)


  Fly   163 YVTDGFGTMPNAAVSYLTQDSQSAYFAVAYQSKLL-LHVMKCSTG--HTIT-HEIKEPKLMPWFL 223
            |:...|.:.......|...|        ||..|.: :|:...|..  :|:| .|:::..|:...|
Yeast    67 YICYHFSSRSTLLTFYPLSD--------AYHGKTINIHLPNASMNQRYTLTIQEVEQQLLVNVIL 123

  Fly   224 SNLKGALTGRSETLEAATSMAFSE---IGGEIFIL-------------VLYRNNELRLWSVDN-- 270
            .:      |...||:...|..||.   :.||.|.|             :.|.:.:..:..:::  
Yeast   124 KD------GSFLTLQLPLSFLFSSANTLNGEWFHLQNPYDFTVRVPHFLFYVSPQFSVVFLEDGG 182

  Fly   271 ---LQTVASINCSTELGQDSAAQGPQNSQLRKISDQNFCLFLSHNSRAEFICVSIMPDADDASVI 332
               |:.|..::....|..|       ||.|:.::     .|.|.:|::::..|.......:..:|
Yeast   183 LLGLKKVDGVHYEPLLFND-------NSYLKSLT-----RFFSRSSKSDYDSVISCKLFHERYLI 235

  Fly   333 NLVQNMVPAPQTDLVDF------------DATSSHIWALWSNAEGDFHVSAAYFASNNAIKWVSA 385
            .|.|| ......||..|            |:..||...:  .|.|::  .:.|   ||.:..:  
Yeast   236 VLTQN-CHLKIWDLTSFTLIQDYDMVSQSDSDPSHFRKV--EAVGEY--LSLY---NNTLVTL-- 290

  Fly   386 ALEPPPDRYCLTMEQGVDPRET-------YCSYIFHPGRFDRNVIAKALY------MFRRVNLQF 437
                      |.:|.|:....|       ..:|.|. .....|:.|.|::      :.|.:.|..
Yeast   291 ----------LPLENGLFQMGTLLVDSSGILTYTFQ-NNIPTNLSASAIWSIVDLVLTRPLELNV 344

  Fly   438 DVKQLSMSVL-------KEQVCQAVEDE-------IQNELKDFVVTDEEY-LEISTRLWD---RF 484
            :...|::.||       |.|:.. |.||       |::..|..|....|: |:|.|:..|   .|
Yeast   345 EASYLNLIVLWKSGTASKLQILN-VNDESFKNYEWIESVNKSLVDLQSEHDLDIVTKTGDVERGF 408

  Fly   485 YSCCEQYHIKLSEPTGLAVLGGMDAVCLVRRQSFALLRPCEVLEHLLLIGEHNDEVATYVAPLFR 549
            .:...:|..::.|                        |..::|....:|..||:: ..|:|.|..
Yeast   409 CNLKSRYGTQIFE------------------------RAQQILSENKIIMAHNED-EEYLANLET 448

  Fly   550 NDPEMAKGFVELMNVVTLLDKLISEDIKIELDKQLYQRESPVEVI----------SKLVARISMI 604
            ...::...|.|..::....|::|..:.....:..||:..:.||..          |:|...:..:
Yeast   449 ILRDVKTAFNEASSITLYGDEIILVNCFQPYNHSLYKLNTTVENWFYNMHSETDGSELFKYLRTL 513

  Fly   605 DDNGPILPSNCVRQIQQKLQNIPNLEPALEMLLDVLCMIDPDEPPHDYSLST--RFLQSSGALMG 667
            :.....|.::.:|.|.:|             .||::....||      |::|  :|.......:.
Yeast   514 NGFASTLSNDVLRSISKK-------------FLDIITGELPD------SMTTVEKFTDIFKNCLE 559

  Fly   668 SEYGLSILSETVKQMAMIRFSVCRNLLVLQYMAYG---QNEMESE---NVLTNLNYLNSYYTLVW 726
            :::.::.|.....::......|..|.|:...|..|   :.:..|.   :..|::..|.|.:.|:.
Yeast   560 NQFEITNLKILFDELNSFDIPVVLNDLINNQMKPGIFWKKDFISAIKFDGFTSIISLESLHQLLS 624

  Fly   727 IAETPISSSTPAGFEASIQRLSRAQLFSGYNRPYSSHLK-----HNGNDQTTLLRLFLESKGLFS 786
            |           .:..::|.|....||......:..|:.     |  ..|..||.|:.:.|.|.:
Yeast   625 I-----------HYRITLQVLLTFVLFDLDTEIFGQHISTLLDLH--YKQFLLLNLYRQDKCLLA 676

  Fly   787 ALTMLLKHDSLSLDSEQLNLRQSLL---QLVGYINKMLWPGSPIY------------VFPEWLFG 836
              .:|||      ||.:.:......   ||:.||:.:   .|.:|            .|..::..
Yeast   677 --EVLLK------DSSEFSFGVKFFNYGQLIAYIDSL---NSNVYNASITENSFFMTFFRSYIIE 730

  Fly   837 TCHHIIVQDYVRILSNWCSV---QKHARRFMLAVSLLDCGEAHKAVHLF--HEAESGIVEDDFLF 896
            ...|..::.::..:.  |..   ....:.||.|::|..||...::..:|  |:....|.:....|
Yeast   731 NTSHKNIRFFLENVE--CPFYLRHNEVQEFMFAMTLFSCGNFDQSYEIFQLHDYPEAINDKLPTF 793

  Fly   897 EHVLKNTPLYGKLQNSVSRGDTISPEDTKLAIVHYYLKVIQLFE----QHSALDYIIQLADMAIR 957
            ...||:...:|   :|:.: |.:...........:|.::..||:    |..||..|.:.|:.:::
Yeast   794 LEDLKSENYHG---DSIWK-DLLCTFTVPYRHSAFYYQLSLLFDRNNSQEFALKCISKSAEYSLK 854

  Fly   958 VLQPDDPQ----------------LPMFQSIVFNNHLQLGHYVEAYTALVNNADISRRKDCLRQL 1006
            .:|.::.|                ..||:.::  :.|:|||                  :||...
Yeast   855 EIQIEELQDFKEKQHIHYLNLLIHFRMFEEVL--DVLRLGH------------------ECLSDT 899

  Fly  1007 VITLFQNKCLPLLMQFSYIGLQDEFESIV----------ESRARSMSI-------DQN------E 1048
            |.|.|    |.||:| ..|..:|.|.:::          |...|::.|       .||      |
Yeast   900 VRTNF----LQLLLQ-EDIYSRDFFSTLLRLCNAHSDNGELYLRTVDIKIVDSILSQNLRSGDWE 959

  Fly  1049 VYNFLYAFHTNKGNMRKASTVMYEQAMRFQVDSDAPNALEKRCSSLLICLNCLHLVDSRY-RWIA 1112
            .:..||.|.....:.|.|:.|:| |.:..|.|.|   .:.||...|:: :|.|...||.| :|| 
Yeast   960 CFKKLYCFRMLNKSERAAAEVLY-QYILMQADLD---VIRKRKCYLMV-INVLSSFDSAYDQWI- 1018

  Fly  1113 KPVLGDEQVITIDQDNDD 1130
               |...:|:|:....|:
Yeast  1019 ---LNGSKVVTLTDLRDE 1033

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup160NP_001285832.1 Nup160 28..530 CDD:288551 83/435 (19%)
NUP120NP_012866.1 Nup160 92..>372 CDD:288551 63/320 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21286
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.