DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup160 and SAR1

Sequence 1:NP_001285832.1 Gene:Nup160 FlyBaseID:FBgn0262647 Length:1411 Species:Drosophila melanogaster
Sequence 2:NP_001185129.1 Gene:SAR1 AraportID:AT1G33410 Length:1504 Species:Arabidopsis thaliana

Alignment Length:1633 Identity:347/1634 (21%)
Similarity:605/1634 (37%) Gaps:411/1634 (25%)


  Fly    24 EWIEVKI--------NTGTQSTLQDLKTFETSGGYCYKNTKNVQTRNRFIYWR---TYQDVLELS 77
            :|||:.:        :.|..|: :|.:..:......|.::..:...:....||   |..:.|||.
plant    24 KWIEISVPSPSVSSSSIGANSS-EDNECVQLPLSEDYASSSVIGEPSISFVWRINKTSPNALELL 87

  Fly    78 EVSLDISLQRNHLRLRF--TDSAVLNVSLTEQGTSVTLLV----VTVSSVHRYVFPLKVA---GQ 133
            ::|.........||..|  |.|....|...|.|.|..|:.    :|.|.|   |:.||::   ..
plant    88 QLSAKSGFPITGLRFVFAQTLSPFAFVYADEGGDSGRLVYFLYSLTPSGV---VYVLKLSNTLAY 149

  Fly   134 EGGAASPEDLLSQSIFYDVNDKINDPSTYYVTDGFGTMPNAAVSYLTQDSQSAYFAVAYQS---- 194
            :.|:..|.|.|   |..||...:|:                  |.:|..:.|..|....:|    
plant   150 KSGSVFPLDHL---IHLDVRPYLNE------------------SRVTSVAASPGFIFLGRSDGCV 193

  Fly   195 ---KLLLHVMKCSTGHTITHEIKEPKLMPWFLSNLKGALTG------RSETLEAATSMAFSEIGG 250
               :.:::..|.|..|   .|:::....        |.|.|      |...:.|...:..||:.|
plant   194 SCFQPIVYFQKSSGFH---QELRDDTGF--------GRLWGFVRLQCRGTVVAAVQDLFISEVHG 247

  Fly   251 EIFILVLYRNNELRLWSV-------------DNLQTVASINCSTELGQDSAAQG--PQNSQLRKI 300
            ..::.||:.:..||:|.:             .||:.|..:.  ..||:.....|  |.....||.
plant   248 RNYLCVLHADGALRVWDILTYSRVLCQSIAAKNLEGVMCVR--LWLGKADYDSGIIPLAVLYRKS 310

  Fly   301 SDQN---FCLFLSHNSRAEFICVSIMPDADDASVINLVQNMVPAPQTDLVDFDATSSHIWALWSN 362
            .:.:   ..::..|.|.||.|.:|:     |:.:.|     :|..:.:|.|...||..||.|.:|
plant   311 MNDSMDVITVYGLHFSSAEGIALSL-----DSGLQN-----IPLEEGELRDVRFTSDKIWTLKAN 365

  Fly   363 AEGDF-------------------HVSAAYF----ASNNAIKWVSAALEPPPDRYCLTMEQGVDP 404
            ....:                   ::|...|    :|::.:...:.:|........:.....:..
plant   366 ELTSYMLCQKSSTMEAQSYTLQEDYISEQLFLSSRSSSHDLLLTTHSLFSSAKDQIMGFISSIFL 430

  Fly   405 RETYCSYIFHPGRFDRNVIAKALYMFRRVN-LQFDVKQLSMSVLKEQVCQAVEDEIQNELKDFVV 468
            |...|..|||      ||..:...:....| ...:.:.||:..|..::...||.|         |
plant   431 RRLLCPGIFH------NVALRLTLLDHNKNWTDSEFQSLSLDELTSEILLLVEHE---------V 480

  Fly   469 TDEEYLEISTRLWDRFYSCCEQYHIKLSEPTGLAVLGGMDAVCLVRRQSFALLRPCEVLEHLL-- 531
            |.|..:.: ...|..|.:....:....:||..|.|..  |.:.|||..|.:|....|..||.|  
plant   481 TAETSISV-FHWWKNFCTSYLHHWCSNNEPRTLLVQS--DVIGLVRNNSVSLFFRLENAEHSLGG 542

  Fly   532 LIGEHNDEVATYVAPLFRNDPEMAKGFVELMNVVTLLDK------------------LISEDIKI 578
            ...||:: :.:....:..:|.|:   ..|::...:.:.|                  :||.|   
plant   543 SSSEHSN-LTSLDLGVSHSDHEI---LAEVLRCTSKISKQWGGAPYAMYYESITGRPIISSD--- 600

  Fly   579 ELDKQLYQRESPVEVISKLVARISMIDDNGPILPSNCVRQIQQK--------------LQNIPNL 629
                         |::.:||          .||.|.....|.|:              |:...||
plant   601 -------------EIVPRLV----------NILESGYSTTIGQRTWSDLGADRAWEKELEAHKNL 642

  Fly   630 EP-ALEMLLDV--LC--------MIDPDEPPHDYSLSTRFLQSSGALMGSEYGLSILSETVKQMA 683
            .. :::|||.:  ||        :....|....|.:..:.:|.:.....|:...|||.:...|..
plant   643 RTFSIDMLLSLSALCQRAGSWEKVFTIMEHYLQYLVPKKSMQKNDGEALSDICSSILVQATSQFV 707

  Fly   684 MIRFSVCRNL-LVLQYM--AYGQNEMESENV----LTNL----NYLNSYYTLVWIAETPISSSTP 737
            .:.|....:: |::.|:  ..||..|..:::    |..|    :.::.:..:::...||..|::.
plant   708 KVMFESAFDIFLLISYLLNIAGQVNMSQQDICKLRLELLPMIQDIVSEWLIILFFVTTPAESTSM 772

  Fly   738 AGFEASIQRLSRAQLFSGYN-RPYSSHLKHNG---------NDQTTL------LRLFLESKGLFS 786
            ..|..   :||..|:.|..: |.:::.|...|         :|::.:      || :|.|..:.:
plant   773 EDFSL---KLSSLQIDSSIDKRSWNAMLGKCGFSLAFILLFSDRSCIVDGRFNLR-YLPSSQIIT 833

  Fly   787 ALTM----LLKHDSLSLDSEQLNLRQSLLQLVGYINKMLWPGSPIYVFPEWLFGTCHHIIVQDYV 847
            :|..    .:::.....||..|..|.:.|.|     :::..|....|  |.:.     ::|:..:
plant   834 SLVQNFISWIRYSKTGDDSSSLLRRSTELSL-----RLIRNGQSDAV--ERIL-----VVVEASL 886

  Fly   848 R----------ILSNWCSVQKHARRFML-------AVSLLDCGEAHKAVHLFHEAESGIVEDDFL 895
            |          ...:||.:| |.|...|       |..:|...:...|:..|..|.||  |..: 
plant   887 RGEKTFGCSQDTSGDWCLLQ-HLRGCCLLDQVQRGASGILRERKIIDAIRCFFRASSG--EGSW- 947

  Fly   896 FEHVLKNTPLYGKLQNSVSRGDTISPEDTKLAI-----------VHYYLKVIQLFEQHSALDYII 949
                        |..:|:|:....||..|..:|           :|||...:|:||:::..:...
plant   948 ------------KALHSLSKEAGFSPATTGPSILDGSTSSAAWKLHYYEWAMQIFERYNISEGAC 1000

  Fly   950 QLADMAIRVLQPDDPQ--LPMFQSI----------------VFNNHLQLGHYVEAYTALVNNADI 996
            |.|..|:.  |.||..  :.|.:..                ||...|.|....:||.|:::|.|.
plant  1001 QFAYAALE--QVDDAYNFIEMTEEFDPTKAATYTRGRLWANVFKFTLDLNLLNDAYCAIISNPDE 1063

  Fly   997 SRRKDCLRQLVITLFQNKCLPLLM--QFSYIGLQDEF-ESIVESRARSMSIDQNEVYNFLYAFHT 1058
            ..::.|||:.:|.||:.....:|.  ...:|||.::. :.:.....||..:.:...|..|||:..
plant  1064 EIKRICLRRFIIVLFECGKTKILSDGHLPFIGLTEKITQELFWKAGRSDIMMKPNPYKLLYAYEM 1128

  Fly  1059 NKGNMRKASTVMYEQAMRFQVDSDAPN------ALEKRCSSLLICLNCLHLVDSRYRWIAKPV-- 1115
            .:.|.|.|::.||:.:.|.:.:....:      .|::|.:.|...:|.|.||...|.|| .||  
plant  1129 RRHNWRMAASYMYQFSARLRSEGACKDYKHMSLVLQERLNGLSAAMNALALVHPGYAWI-DPVPE 1192

  Fly  1116 ------------LGDEQVITIDQDNDDGEPKCDEDKRGQEVVVLELADIRRELVH--AEALRELS 1166
                        ..:||:.:.||..  ||..|           :::..::.|.|.  ||.:..|.
plant  1193 ETTRYPVKKARRAEEEQLRSNDQPK--GEKSC-----------IDIEKLQNEFVFTTAEYMLSLK 1244

  Fly  1167 FYRKDTAAYERATPEELSYLLASSGLY----TAALKLSRGHSF--SVLPIFESLTSACVAATEDK 1225
            .:....:..|: .|.:|..||..:.||    |..||..||.:.  .:..|||::...|..|....
plant  1245 NFGWTYSGLEK-PPSDLVDLLVQANLYDMAFTVVLKFWRGSALKRELEKIFENMAIKCCPAKGTL 1308

  Fly  1226 SSDAWNWLQNND--MADLPHRSNA---ADMA--WTLLQ---KLVVDNEAKDSTLIRKSVVQRLLG 1280
            .|.....|.:||  :...|.||.|   :.:|  |.:|:   |..:|..|:    :..||...||.
plant  1309 WSSPNLMLTSNDEEVTHSPDRSPADQGSKLAGDWEILEVYLKRYIDIHAR----LPVSVASTLLQ 1369

  Fly  1281 LNAF--LPQWLINSYKLSHSRE-------------LLHLLVKHNRLLEAADLGCEIIAGMLGAGS 1330
            .::.  ||.|||..:|.....:             |..|.|.:.||.||.:|..|.:...  |.|
plant  1370 ADSCIELPLWLIQMFKDGQKEKALGMAGQEASPASLFQLYVDYGRLTEATNLLLEYMESF--ASS 1432

  Fly  1331 EYFEFKHAVNIANPQLCFPISTIDLLLHGLKINGKDDLDYEMAYFKLEEEVQ----RYIETIKRT 1391
            :..|......::.  :.||.:|::.|...|:.........|..: ||:|::.    .:::.:|..
plant  1433 KPAEVLKRKKVSG--VWFPYTTVERLWWELEKTMNSGRMVEQCH-KLKEQLHHALLNHLKLLKVD 1494

  Fly  1392 TDDKMSMA 1399
            ::|.:|.|
plant  1495 SNDAVSSA 1502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup160NP_001285832.1 Nup160 28..530 CDD:288551 119/577 (21%)
SAR1NP_001185129.1 Nup160 56..539 CDD:288551 116/548 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D284127at2759
OrthoInspector 1 1.000 T192269
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21286
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.