DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup160 and Nup160

Sequence 1:NP_001285832.1 Gene:Nup160 FlyBaseID:FBgn0262647 Length:1411 Species:Drosophila melanogaster
Sequence 2:NP_067487.1 Gene:Nup160 MGIID:1926227 Length:1402 Species:Mus musculus

Alignment Length:1451 Identity:415/1452 (29%)
Similarity:693/1452 (48%) Gaps:158/1452 (11%)


  Fly    33 GTQS-TLQDLKTFETSGGYCYKNTKNV--QTRNRFIYWRTYQDVLELSEVSLDISLQRNHLRLRF 94
            ||.| ....:|..|::||:.|..:..:  .||||||:|:|..|.|||.|.|||::|..|.:||:|
Mouse    34 GTASAAFGTVKYSESAGGFYYVESGKLFSITRNRFIHWKTSGDTLELVEESLDLNLLNNAVRLKF 98

  Fly    95 TDSAVL--NVSLTEQGTSVTLLVVTVSSVHRYVFPLKVAGQEGGAASPEDLLSQSIFYDVNDKIN 157
            .:..:|  .|.::|....|.:|::|..:|||.:.|...........:...:  ||||.|:. |::
Mouse    99 QNYNILPGGVHVSETQNHVIILILTNQTVHRLILPHPSRMYRSELVTESQM--QSIFTDIG-KVD 160

  Fly   158 --DP-STYYVTDGFGTMPNAAVS--YLTQDSQSAYFAVAYQSKLLLHVMKCS----TGHTITHEI 213
              || ::..:....|..|.:..|  :|:.|.: |.||:...|..:. |:|..    .|.....|:
Mouse   161 FRDPCNSQLIPSVPGLSPGSTTSAAWLSSDGE-ALFALPSASGGIF-VLKLPPYDVPGIASVVEL 223

  Fly   214 KEPKLMPWFLSN-LKGALTGRSETLEAATSMAFSEIGGEIFILVLYRNNELRLWSVDNLQTVASI 277
            |:..:|...|:. :..|:.|.....:.|.|:|...:..:.||..|.::::||:||..:...:   
Mouse   224 KQSSVMQRLLTGWMPTAIRGDHGPSDRALSLAVHCVEHDAFIFALCQDHKLRMWSYKDQMCL--- 285

  Fly   278 NCSTELGQDSAAQGPQNSQLRKISDQNFCLFLSHN--------------SRAEFICVSIMPDADD 328
                 :..|.....|.|..||..:.....|.|:::              .|.:|....::...::
Mouse   286 -----MVADMLEYVPVNKDLRLTAGTGHKLRLAYSPSMGLYLGIYMHAPKRGQFCVFQLVSTENN 345

  Fly   329 ASVINLVQNMVPAPQTDLVDFDATSSHIWALWSNAEGDFHVSAAYFASNNAIKWVSAALEPPPDR 393
            ...::.:.::..:.:| ||||..||:.|||||.:||....|....|..|.|.:|....::|.|:.
Mouse   346 RYSLDHISSLFTSQET-LVDFALTSTDIWALWHDAENQTIVKYINFEHNVAGQWNPVFMQPLPEE 409

  Fly   394 YCLTMEQGVDPRETYCSYIFHPGRFDRNVIAKALYMFRR---VNLQFDVKQLSMSVLKEQVCQAV 455
            . :.:....||||.|...:|.||.|....:.|||.:|.|   .||     .||.:.||:::..||
Mouse   410 E-IVIRDDQDPREMYLRSLFTPGHFINAALCKALQIFCRGTERNL-----DLSWNELKKEITLAV 468

  Fly   456 EDEIQNELKDFVVTDEEYLEISTRLWDRFYSCCEQYHIKLSEPTGLAVLGGMDAVCLVRRQSFAL 520
            |:|:|..:.::..:.:|:..:....|.:||:|..||...||.|..|.:....:.|||:::...:.
Mouse   469 ENELQGSVTEYEFSQDEFRTLQQEFWCKFYACVLQYQEALSHPLALHLNPVTNMVCLLKKGYLSF 533

  Fly   521 LRPCEVLEHL-LLIGEH---NDEVATYVAPLFRNDPEMAKGFVELMNVVTLLDKLISEDIKIELD 581
            |.|..:::|| ||..||   .||..      ..:|.::|:..:.|:..:.::.:.::.|:.:.::
Mouse   534 LVPSSLVDHLYLLPDEHLLTEDETT------ISDDADVARDVLCLIKCLRMIGESVTMDMAVLME 592

  Fly   582 KQLYQRESPVEVISKLVARISMIDDNGPILPSNCVRQIQQKLQNIPNLEPALEMLL--------- 637
            ...|..:||.:....::..:..||      ..|.:..|..|||.|.|...|:.:|:         
Mouse   593 TSCYNLQSPEKAAEHILEDLITID------VENVMEDICSKLQEIRNPVHAIGLLIREMDYETEV 651

  Fly   638 DVLCMIDPDEPPHDYSLSTRFLQSSGALMGSEYGLSILSETVKQMAMIRFSVCRNLLVLQ----- 697
            ::....||.:|     |:.|...|.  |.||.....|:...|.::|..||.:||:||:||     
Mouse   652 EMEKGFDPAQP-----LNVRMNLSQ--LYGSSTAGYIVCRGVYKIASTRFLICRDLLILQQLLTR 709

  Fly   698 -----YMAYGQNEMESENVL-TNLNYLNSYYTLVWIAETPISSSTPAG-FEASIQRLSRAQLF-S 754
                 .:..||.....:::| .....|.|||.:.|.::. :::..|.. .|:::|.||..:|. |
Mouse   710 LGDAVILGAGQLFQAQQDLLHRTAPLLLSYYLIKWASQC-LATDVPVDTLESNLQHLSVLELTDS 773

  Fly   755 G---YNRPYSSHLKHNGNDQTTLLRLFLESKGLFSALTMLLKHDSLSLDSEQLNLRQSLLQLVGY 816
            |   .|:..||        ..|::.||.:.......::.|.......|....||..:.:..:.||
Mouse   774 GALMANKLVSS--------PQTIMELFFQEVARKQIISHLFSQPKAPLSQTGLNWPEMITAVTGY 830

  Fly   817 INKMLWPGSPIYVFPEWLFGTCHHIIVQDYVRILSNWCSVQKHARRFMLAVSLLDCGEAHKAVHL 881
            :.::|||.:|..:|.|.|.|.|.::.:|||:::|..||.|...:.||||....|..||..||:..
Mouse   831 LLQLLWPSNPGCLFLECLMGNCQYVQLQDYIQLLHPWCQVNVGSCRFMLGRCYLVTGEVQKALEC 895

  Fly   882 FHEAESGIVEDDFLFEHVLKNTPLYGKLQNSVSRGDTIS-PEDTKLAIVHYYLKVIQLFEQHSAL 945
            |.:|.|.:.:::|| :.::::           ..|:.:| |:      :.||.||::|.:.....
Mouse   896 FCQAASEVGKEEFL-DRLIRS-----------EDGEIVSTPK------LQYYDKVLRLLDVVGLP 942

  Fly   946 DYIIQLADMAIRVLQPDDPQLPMFQSIVFNNHLQLGHYVEAYTALVNNADISRRKDCLRQLVITL 1010
            :.:||||..||.....|.......::.:|.:||.|||..:||.||....|.||:.|||||||:.|
Mouse   943 ELVIQLATSAITEAGDDWKSQATLRTCIFKHHLDLGHNSQAYEALTQIPDSSRQLDCLRQLVVVL 1007

  Fly  1011 FQNKCLPLLMQFSYIGLQDEFESIVESRARSMSIDQNEVYNFLYAFHTNKGNMRKASTVMYEQAM 1075
            .:...|..|::|.|:.|.:|...|:|||||::.:..:..|..|||||..:.|.|||.|||:|..|
Mouse  1008 CERSQLQDLVEFPYVNLHNEVVGIIESRARAVDLMTHNYYELLYAFHIYRHNYRKAGTVMFEYGM 1072

  Fly  1076 RFQVDSDAPNALEKRCSSLLICLNCLHLVDSRYRWIAKPVLG--DEQVITIDQDNDDGEPKCDED 1138
            |...:......|||:.:..|..:|||.|:...|.||.:|..|  .::.....:.|.|||  |...
Mouse  1073 RLGREVRTLRGLEKQGNCYLAAINCLRLIRPEYAWIVQPASGAVSDRPGASPKRNHDGE--CTAA 1135

  Fly  1139 KRGQEVVVLELADIRRELVHAEALRELSFYRKDTAAYERA---TPEELSYLLASSGLYTAALKLS 1200
            ...:::.:|||.|:.:|  ::.|...|:..|.|.:....|   :.:|:|.||..:||:..|:.|.
Mouse  1136 PTNRQIEILELEDLEKE--YSLARIRLTLARHDPSVIAIAGSSSAKEMSALLVQAGLFDTAISLC 1198

  Fly  1201 RGHSFSVLPIFESLTSACVA---ATEDKSSDAWNWLQNNDMADL--PHRSNAADMAW----TLLQ 1256
            :..:..:.|:||.|...|:.   ..|....:||:||..|.::.:  ...|:|.|.||    |.|:
Mouse  1199 QTFTLPLTPVFEGLAFKCIKLQFGGEAAQGEAWSWLATNQLSSVITTKESSATDEAWRLLSTYLE 1263

  Fly  1257 KLVVDNEAKDSTLIRKSVVQRLLGLNAFLPQWLINSYKLSHSRELLHLLVKHNRLLEAADLGCEI 1321
            :..|.|     .|....|:.:||.....||.|||||||...:.|||.|.:.::.|.||.||..|.
Mouse  1264 RYKVQN-----NLYHHCVINKLLSHGVPLPNWLINSYKKVDAAELLRLYLNYDLLEEAVDLVSEY 1323

  Fly  1322 IAGMLGAGSEYFEFKHAVNIANPQLCFPISTIDLLLHGLKINGKDDLDYEMAYFKLEEEVQRYIE 1386
            :..:||.|.:||..:..::...|.:..|.|:||.||..|..|..:..:..::. |:.::::.|.:
Mouse  1324 VDAVLGKGHQYFGIEFPLSATAPMVWLPYSSIDQLLQALGENSANSHNIILSQ-KILDKLEDYQQ 1387

  Fly  1387 TIKRTTDDKMSMAVLQMRTDL 1407
            .:.:.|.|      |..|.||
Mouse  1388 KVDKATRD------LLYRRDL 1402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup160NP_001285832.1 Nup160 28..530 CDD:288551 147/529 (28%)
Nup160NP_067487.1 Nup160 28..543 CDD:288551 154/545 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C348841550
eggNOG 1 0.900 E1_KOG4521
Hieranoid 1 1.000
Homologene 1 1.000 H32509
Inparanoid 1 1.050 510 1.000 Inparanoid score I1302
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003982
OrthoInspector 1 1.000 T1084421
orthoMCL 1 0.900 OOG5_132810
Panther 1 1.100 LDO PTHR21286
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4695
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.