DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup160 and Nup160

Sequence 1:NP_001285832.1 Gene:Nup160 FlyBaseID:FBgn0262647 Length:1411 Species:Drosophila melanogaster
Sequence 2:NP_001101214.1 Gene:Nup160 RGDID:1311052 Length:1379 Species:Rattus norvegicus

Alignment Length:1444 Identity:407/1445 (28%)
Similarity:671/1445 (46%) Gaps:184/1445 (13%)


  Fly    41 LKTFETSGGYCYKNTKNV--QTRNRFIYWRTYQDVLELSEVSLDISLQRNHLRLRFTDSAVL--N 101
            :|..|::||:.|..:..:  .||||||:|:|..|.|||.|.|||::|..|.:||:|.:.::|  .
  Rat    43 VKYSESAGGFYYVESGKLFSITRNRFIHWKTSGDTLELVEESLDLNLLNNAVRLKFQNYSLLPGG 107

  Fly   102 VSLTEQGTSVTLLVVTVSSVHRYVFPLKVAGQEGGAASPEDLLSQSIFYDVNDKIN--DPSTYYV 164
            |.::|....|.:|::|..:|||.:.|...........:...:  ||||.|:. |::  ||..|.:
  Rat   108 VHVSETQNHVIILILTNHTVHRLILPHPSRMYRSELVTESQM--QSIFTDIG-KVDFKDPCNYQL 169

  Fly   165 ---TDGFGTMPNAAVSYLTQDSQSAYFAVAYQSKLLLHVMKCS----TGHTITHEIKEPKLMPWF 222
               ..|.......:.::|:.|.: |.||:...|..:. |:|..    .|.....|:|:..:|...
  Rat   170 IPTVPGLSPSSTTSAAWLSSDGE-ALFALPSASGGIF-VLKLPPYDIPGIASVVELKQSSVMQRL 232

  Fly   223 LSN-LKGALTGRSETLEAATSMAFSEIGGEIFILVLYRNNELRLWSVDNLQTVASINCSTELGQD 286
            |:. :..|:.|.....:.|.|:|...:..:.||..|.::::||:||..:...:        :..|
  Rat   233 LTGWMPTAIRGDHGPSDRALSLAVHCVEHDAFIFALCQDHKLRMWSYKDQMCL--------MVAD 289

  Fly   287 SAAQGPQNSQLRKISDQNFCLFLSHN--------------SRAEFICVSIMPDADDASVINLVQN 337
            .....|.|..||..:.....|.|:::              .|.:|....::........::.:.:
  Rat   290 MLEYVPVNKDLRLTAGTGHKLRLAYSPSMGLYLGIYMHAPKRGQFCIFQLVSTESSRYSLDHISS 354

  Fly   338 MVPAPQTDLVDFDATSSHIWALWSNAEGDFHVSAAYFASNNAIKWVSAALEPPPDRYCLTMEQGV 402
            :..:.:| ||||..||:.|||||.:||....|....|..|.|.:|....::..|:.. :.:....
  Rat   355 LFTSQET-LVDFALTSTDIWALWHDAENQTIVKYINFEHNVAGQWNPVFMQSLPEEE-IVIRDDQ 417

  Fly   403 DPRETYCSYIFHPGRFDRNVIAKALYMFRRVNLQFDVKQLSMSVLKEQVCQAVEDEIQNELKDFV 467
            |||      ||..|. :||:                  .||.|.||:::..|||:|:|..:.::.
  Rat   418 DPR------IFCRGT-ERNL------------------DLSWSELKKEITLAVENELQGSVTEYE 457

  Fly   468 VTDEEYLEISTRLWDRFYSCCEQYHIKLSEPTGLAVLGGMDAVCLVRRQSFALLRPCEVLEHL-L 531
            .:.:|:..:....|.:||:||.||...||.|..|.:....:.|||:::...:.|.|..:::|| |
  Rat   458 FSQDEFRTLQQEFWCKFYACCLQYQEALSHPLALHLNPLTNMVCLLKKGYLSFLVPSSLVDHLYL 522

  Fly   532 LIGEH---NDEVATYVAPLFRNDPEMAKGFVELMNVVTLLDKLISEDIKIELDKQLYQRESPVEV 593
            |..||   .||..      ..:|.::|:..:.|:..:.::.:.::.|:.:.::...|..:||.:.
  Rat   523 LPDEHLLTEDETT------ISDDADVARDVLCLIKCLRMIGESVTMDMAVLMETSCYNLQSPEKA 581

  Fly   594 ISKLVARISMIDDNGPILPSNCVRQIQQKLQNIPNLEPALEMLL---------DVLCMIDPDEPP 649
            ...::..:..||      ..|.:..|..|||.|.|...|:.:|:         ::....||.:| 
  Rat   582 AEHILEDLITID------VENVMEDICSKLQEIRNPVHAIGLLIREMDYETEVEMEKGFDPAQP- 639

  Fly   650 HDYSLSTRFLQSSGALMGSEYGLSILSETVKQMAMIRFSVCRNLLVLQ----------YMAYGQN 704
                |:.|...|.  |.||.....|:...|.::|..||.:||:||:||          .:..||.
  Rat   640 ----LNVRMNLSQ--LYGSSTAGYIVCRGVYKIASTRFLICRDLLILQQLLTRLGDAVILGAGQL 698

  Fly   705 EMESENVL-TNLNYLNSYYTLVWIAETPISSSTPAG-FEASIQRLSRAQLF-SG---YNRPYSSH 763
            ....:::| .....|.|||.:.|.::. :::..|.. .|:::|.||..:|. ||   .|:..|| 
  Rat   699 FQAQQDLLHRTAPLLLSYYLIKWSSQC-LATDVPVDTLESNLQHLSVLELTDSGALMANKLVSS- 761

  Fly   764 LKHNGNDQTTLLRLFLESKGLFSALTMLLKHDSLSLDSEQLNLRQSLLQLVGYINKMLWPGSPIY 828
                   ..|::.||.:.......::.|.......|....||..:.:..:.||:.::|||.:|..
  Rat   762 -------PQTIMELFFQEVARKHIISHLFSQPKAPLSQTGLNWPEMVTAVTGYLLQLLWPSNPGC 819

  Fly   829 VFPEWLFGTCHHIIVQDYVRILSNWCSVQKHARRFMLAVSLLDCGEAHKAVHLFHEAESGIVEDD 893
            :|.|.|.|.|.::.:|||:::|..||.|...:.||||....|..||..||:..|.:|.|.:.:::
  Rat   820 LFLECLMGNCQYVQLQDYIQLLHPWCQVNVGSCRFMLGRCYLVTGEVQKALECFCQAASEVGKEE 884

  Fly   894 FLFEHV------LKNTPLYGKLQNSVSRGDTISPEDTKLAIVHYYLKVIQLFEQHSALDYIIQLA 952
            ||...:      :.:||   |||                    ||.||::|.:.....:.:||||
  Rat   885 FLDRLIRTEDGEIVSTP---KLQ--------------------YYDKVLRLLDVVGLPELVIQLA 926

  Fly   953 DMAIRVLQPDDPQLPMFQSIVFNNHLQLGHYVEAYTALVNNADISRRKDCLRQLVITLFQNKCLP 1017
            ..||.....|.......::.:|.:||.|||..:||.||....|.||:.|||||||:.|.:...|.
  Rat   927 TSAITEAGDDWKSQATLRTCIFKHHLDLGHNSQAYEALTQIPDSSRQLDCLRQLVVVLCERSQLQ 991

  Fly  1018 LLMQFSYIGLQDEFESIVESRARSMSIDQNEVYNFLYAFHTNKGNMRKASTVMYEQAMRFQVDSD 1082
            .|::|.|:.|.:|...|:|||||::.:..:..|..|||||..:.|.|||.|||:|..||...:..
  Rat   992 DLVEFPYVNLHNEVVGIIESRARAVDLMTHNYYELLYAFHIYRHNYRKAGTVMFEYGMRLGREVR 1056

  Fly  1083 APNALEKRCSSLLICLNCLHLVDSRYRWIAKPVLG--DEQVITIDQDNDDGEPKCDEDKRGQEVV 1145
            ....|||:.:..|..:|||.|:...|.||.:|..|  .::.....:.|.|||  |......:::.
  Rat  1057 TLGGLEKQGNCYLAAINCLRLIRPEYAWIVQPASGAVSDRPGASPKRNHDGE--CTAAPTNRQIE 1119

  Fly  1146 VLELADIRRELVHAEALRELSFYRKDTAAYERA---TPEELSYLLASSGLYTAALKLSRGHSFSV 1207
            :|||.|:.:|...|..  .|:..|.|.:|...|   :.:|:|.||..:||:..|:.|.:.....:
  Rat  1120 ILELEDLEKECSLARI--RLTLARHDPSAIAIAGSSSAKEMSTLLVQAGLFDTAISLCQTFKLPL 1182

  Fly  1208 LPIFESLTSACVA---ATEDKSSDAWNWLQNNDMADL--PHRSNAADMAW----TLLQKLVVDNE 1263
            .|:||.|...|:.   ..|....:||.||..|.::.:  ...|:|.|.||    |.|::..|.| 
  Rat  1183 TPVFEGLAFKCIKLQFGGEAAQGEAWAWLAANQLSSVITTKESSATDEAWRLLSTYLERYKVQN- 1246

  Fly  1264 AKDSTLIRKSVVQRLLGLNAFLPQWLINSYKLSHSRELLHLLVKHNRLLEAADLGCEIIAGMLGA 1328
                .|....|:.:||.....||.|||||||...:.|||.|.:.::.|.||.||..|.:..:||.
  Rat  1247 ----NLYHHCVINKLLSHGVPLPNWLINSYKKVDAAELLRLYLNYDLLEEAVDLVSEYVDAVLGK 1307

  Fly  1329 GSEYFEFKHAVNIANPQLCFPISTIDLLLHGLKINGKDDLDYEMAYFKLEEEVQRYIETIKRTTD 1393
            |.:||..:..::...|.:..|.|:||.||..|..|..:..:..::. |:.::::.|.:.:.:.|.
  Rat  1308 GHQYFGIEFPLSATAPMVWLPYSSIDQLLQALGENSANSHNIILSQ-KILDKLEDYQQKVDKATR 1371

  Fly  1394 DKMSMAVLQMRTDL 1407
            |      |..|.||
  Rat  1372 D------LLYRRDL 1379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup160NP_001285832.1 Nup160 28..530 CDD:288551 136/517 (26%)
Nup160NP_001101214.1 Nup160 28..520 CDD:288551 133/505 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C348838660
eggNOG 1 0.900 E1_KOG4521
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32509
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D284127at2759
OrthoFinder 1 1.000 FOG0003982
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132810
Panther 1 1.100 LDO PTHR21286
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.