DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup160 and NUP160

Sequence 1:NP_001285832.1 Gene:Nup160 FlyBaseID:FBgn0262647 Length:1411 Species:Drosophila melanogaster
Sequence 2:NP_056046.1 Gene:NUP160 HGNCID:18017 Length:1436 Species:Homo sapiens

Alignment Length:1455 Identity:420/1456 (29%)
Similarity:688/1456 (47%) Gaps:186/1456 (13%)


  Fly    41 LKTFETSGGYCYKNTKNV--QTRNRFIYWRTYQDVLELSEVSLDISLQRNHLRLRFTDSAVL--N 101
            :|..|::||:.|..:..:  .||||||:|:|..|.|||.|.||||:|..|.:||:|.:.:||  .
Human    77 VKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGG 141

  Fly   102 VSLTEQGTSVTLLVVTVSSVHRYVFP---------LKVAGQEGGAASPEDLLSQSIFYDVNDKIN 157
            |.::|....|.:|::|..:|||.:.|         |.|..|           .||||.|:. |::
Human   142 VYVSETQNRVIILMLTNQTVHRLLLPHPSRMYRSELVVDSQ-----------MQSIFTDIG-KVD 194

  Fly   158 --DPSTYYVTDGF-GTMPN--AAVSYLTQDSQSAYFAVAYQSKLLLHVMKCS----TGHTITHEI 213
              ||..|.:.... |..||  |:.::|:.|.: |.||:...|..:. |:|..    .|.....|:
Human   195 FTDPCNYQLIPAVPGISPNSTASTAWLSSDGE-ALFALPCASGGIF-VLKLPPYDIPGMVSVVEL 257

  Fly   214 KEPKLMPWFLSN-LKGALTGRSETLEAATSMAFSEIGGEIFILVLYRNNELRLWS---------V 268
            |:..:|...|:. :..|:.|.....:...|:|...:..:.||..|.::::||:||         .
Human   258 KQSSVMQRLLTGWMPTAIRGDQSPSDRPLSLAVHCVEHDAFIFALCQDHKLRMWSYKEQMCLMVA 322

  Fly   269 DNLQTVASINCSTELGQDSAAQGPQNSQLRKISDQNFCLFLSHN--------------SRAEFIC 319
            |.|:.|                 |....||..:.....|.|:::              .|.:|..
Human   323 DMLEYV-----------------PVKKDLRLTAGTGHKLRLAYSPTMGLYLGIYMHAPKRGQFCI 370

  Fly   320 VSIMPDADDASVINLVQNMVPAPQTDLVDFDATSSHIWALWSNAEGDFHVSAAYFASNNAIKWVS 384
            ..::....:...::.:.::..:.:| |:||..||:.|||||.:||....|....|..|.|.:|..
Human   371 FQLVSTESNRYSLDHISSLFTSQET-LIDFALTSTDIWALWHDAENQTVVKYINFEHNVAGQWNP 434

  Fly   385 AALEPPPDRYCLTMEQGVDPRETYCSYIFHPGRFDRNVIAKALYMFRR---VNLQFDVKQLSMSV 446
            ..::|.|:.. :.:....||||.|...:|.||:|....:.|||.:|.|   .||     .||.|.
Human   435 VFMQPLPEEE-IVIRDDQDPREMYLQSLFTPGQFTNEALCKALQIFCRGTERNL-----DLSWSE 493

  Fly   447 LKEQVCQAVEDEIQNELKDFVVTDEEYLEISTRLWDRFYSCCEQYHIKLSEPTGLAVLGGMDAVC 511
            ||::|..|||:|:|..:.::..:.||:..:....|.:||:||.||...||.|..|.:....:.||
Human   494 LKKEVTLAVENELQGSVTEYEFSQEEFRNLQQEFWCKFYACCLQYQEALSHPLALHLNPHTNMVC 558

  Fly   512 LVRRQSFALLRPCEVLEHLLLIGEHN----DEVATYVAPLFRNDPEMAKGFVELMNVVTLLDKLI 572
            |:::...:.|.|..:::||.|:...|    ||..      ..:|.::|:..:.|:..:.|:::.:
Human   559 LLKKGYLSFLIPSSLVDHLYLLPYENLLTEDETT------ISDDVDIARDVICLIKCLRLIEESV 617

  Fly   573 SEDIKIELDKQLYQRESPVEVISKLVARISMIDDNGPILPSNCVRQIQQKLQNIPNLEPALEML- 636
            :.|:.:.::...|..:||.:...:::..:..||      ..|.:..|..|||.|.|...|:.:| 
Human   618 TVDMSVIMEMSCYNLQSPEKAAEQILEDMITID------VENVMEDICSKLQEIRNPIHAIGLLI 676

  Fly   637 --LDVLCMIDPDE---PPHDYSLSTRFLQSSGALMGSEYGLSILSETVKQMAMIRFSVCRNLLVL 696
              :|....::.::   |....::.....|    |.||.....|:...|.::|..||.:||:||:|
Human   677 REMDYETEVEMEKGFNPAQPLNIRMNLTQ----LYGSNTAGYIVCRGVHKIASTRFLICRDLLIL 737

  Fly   697 QYM----------AYGQNEMESENVL-TNLNYLNSYYTLVWIAETPISSSTPAG-FEASIQRLSR 749
            |.:          ..||.....:::| .....|.|||.:.|.:|. :::..|.. .|:::|.||.
Human   738 QQLLMRLGDAVIWGTGQLFQAQQDLLHRTAPLLLSYYLIKWGSEC-LATDVPLDTLESNLQHLSV 801

  Fly   750 AQLF-SG---YNRPYSSHLKHNGNDQTTLLRLFLESKGLFSALTMLLKHDSLSLDSEQLNLRQSL 810
            .:|. ||   .||..||        ..|::.||.:.......::.|.......|....||..:.:
Human   802 LELTDSGALMANRFVSS--------PQTIVELFFQEVARKHIISHLFSQPKAPLSQTGLNWPEMI 858

  Fly   811 LQLVGYINKMLWPGSPIYVFPEWLFGTCHHIIVQDYVRILSNWCSVQKHARRFMLAVSLLDCGEA 875
            ..:..|:.::|||.:|..:|.|.|.|.|.::.:|||:::|..||.|...:.||||....|..||.
Human   859 TAITSYLLQLLWPSNPGCLFLECLMGNCQYVQLQDYIQLLHPWCQVNVGSCRFMLGRCYLVTGEG 923

  Fly   876 HKAVHLFHEAESGIVEDDFLFEHVLKNTPLYGKLQNSVSRGDTIS-PEDTKLAIVHYYLKVIQLF 939
            .||:..|.:|.|.:.:::|| :.::::           ..|:.:| |.      :.||.||::|.
Human   924 QKALECFCQAASEVGKEEFL-DRLIRS-----------EDGEIVSTPR------LQYYDKVLRLL 970

  Fly   940 EQHSALDYIIQLADMAIRVLQPDDPQLPMFQSIVFNNHLQLGHYVEAYTALVNNADISRRKDCLR 1004
            :.....:.:||||..||.....|.......::.:|.:||.|||..:||.||....|.||:.||||
Human   971 DVIGLPELVIQLATSAITEAGDDWKSQATLRTCIFKHHLDLGHNSQAYEALTQIPDSSRQLDCLR 1035

  Fly  1005 QLVITLFQNKCLPLLMQFSYIGLQDEFESIVESRARSMSIDQNEVYNFLYAFHTNKGNMRKASTV 1069
            |||:.|.:...|..|::|.|:.|.:|...|:|||||::.:..:..|..|||||..:.|.|||.||
Human  1036 QLVVVLCERSQLQDLVEFPYVNLHNEVVGIIESRARAVDLMTHNYYELLYAFHIYRHNYRKAGTV 1100

  Fly  1070 MYEQAMRFQVDSDAPNALEKRCSSLLICLNCLHLVDSRYRWIAKPVLGD--EQVITIDQDNDDGE 1132
            |:|..||...:......|||:.:..|..||||.|:...|.||.:||.|.  ::.....:.|.|||
Human  1101 MFEYGMRLGREVRTLRGLEKQGNCYLAALNCLRLIRPEYAWIVQPVSGAVYDRPGASPKRNHDGE 1165

  Fly  1133 PKCDEDKRGQEVVVLELADIRRELVHAEALRELSFYRKDTAAYERA---TPEELSYLLASSGLYT 1194
              |......:::.:|||.|:.:|...|..  .|:..:.|.:|...|   :.||:..||..:||:.
Human  1166 --CTAAPTNRQIEILELEDLEKECSLARI--RLTLAQHDPSAVAVAGSSSAEEMVTLLVQAGLFD 1226

  Fly  1195 AALKLSRGHSFSVLPIFESLTSACVA---ATEDKSSDAWNWLQNNDMADL--PHRSNAADMAW-- 1252
            .|:.|.:.....:.|:||.|...|:.   ..|...::||.||..|.::.:  ...|:|.|.||  
Human  1227 TAISLCQTFKLPLTPVFEGLAFKCIKLQFGGEAAQAEAWAWLAANQLSSVITTKESSATDEAWRL 1291

  Fly  1253 --TLLQKLVVDNEAKDSTLIRKSVVQRLLGLNAFLPQWLINSYKLSHSRELLHLLVKHNRLLEAA 1315
              |.|::..|.|     .|....|:.:||.....||.|||||||...:.|||.|.:.::.|.||.
Human  1292 LSTYLERYKVQN-----NLYHHCVINKLLSHGVPLPNWLINSYKKVDAAELLRLYLNYDLLEEAV 1351

  Fly  1316 DLGCEIIAGMLGAGSEYFEFKHAVNIANPQLCFPISTIDLLLHGLKINGKDDLDYEMAYFKLEEE 1380
            ||..|.:..:||.|.:||..:..::...|.:..|.|:||.||..|..|..:..:..::. |:.::
Human  1352 DLVSEYVDAVLGKGHQYFGIEFPLSATAPMVWLPYSSIDQLLQALGENSANSHNIALSQ-KILDK 1415

  Fly  1381 VQRYIETIKRTTDDKMSMAVLQMRT 1405
            ::.|.:.:.:.|.|     :|..||
Human  1416 LEDYQQKVDKATRD-----LLYRRT 1435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup160NP_001285832.1 Nup160 28..530 CDD:288551 154/538 (29%)
NUP160NP_056046.1 Nup160 62..577 CDD:288551 154/538 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C348840901
eggNOG 1 0.900 E1_KOG4521
Hieranoid 1 1.000
Homologene 1 1.000 H32509
Inparanoid 1 1.050 522 1.000 Inparanoid score I1247
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D284127at2759
OrthoFinder 1 1.000 FOG0003982
OrthoInspector 1 1.000 T1074326
orthoMCL 1 0.900 OOG5_132810
Panther 1 1.100 LDO PTHR21286
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4695
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.