DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup160 and npp-6

Sequence 1:NP_001285832.1 Gene:Nup160 FlyBaseID:FBgn0262647 Length:1411 Species:Drosophila melanogaster
Sequence 2:NP_740844.1 Gene:npp-6 WormBaseID:WBGene00003792 Length:1562 Species:Caenorhabditis elegans

Alignment Length:1702 Identity:294/1703 (17%)
Similarity:578/1703 (34%) Gaps:544/1703 (32%)


  Fly    20 LSPAEWIEVKINTGTQSTLQDLKTFETSGGYCYKNTKNVQTRNRFIYWRTYQDVLELSEVSLDIS 84
            :.||....|..|....|...|::  .::|...:.:..|.  .:|...||.....|.:.|.||..|
 Worm    57 IKPARTFVVNTNAPLHSNGFDVQ--PSAGVATFPHCSNY--GDRIFLWRAIGQKLFIEERSLLYS 117

  Fly    85 LQRNHLRLRFTDSAVL---NVSLTEQGTSVTLLVVTVSSVHRYVFPLKVAGQEGGAASPEDLLSQ 146
            :....|.:.||.:.::   ::::.|:|. :.::|.|.|::||:...|...|.:          :.
 Worm   118 ITDGSLCIDFTRTPIIPGTSITIFEEGV-LCIVVPTASAIHRFYARLHSKGHD----------TF 171

  Fly   147 SIFYDVNDKINDPSTYYVTDGFGTMPNA-------------AVSYLTQDSQSAYFAVAYQSKLLL 198
            ||...:  |.:|....:.|....:.|..             .:||.|.:.|           |::
 Worm   172 SILARI--KEDDDFRRFRTSHSLSTPGRPIRASVTHHPSRNTISYCTAEGQ-----------LVI 223

  Fly   199 HVMKCSTGHTITHE---IKEPKLMPWFLSNLKGALTGRSE------------------TLEAATS 242
            ..:...|..:..||   :.|..|:        |.|.|.::                  |.|...|
 Worm   224 VTLGSYTESSDKHEEFTMGEVGLL--------GKLLGGTDKRVSDACVMKNLRPTSGVTRERKIS 280

  Fly   243 MAFSEIGGEIFILVLYRNNELRLWSVD---NLQTVASINC--------------STELGQDSAAQ 290
            :. |:|     :..:.|:..::.|:|:   .|.:...:|.              |.:..::.:..
 Worm   281 VQ-SDI-----VFAVTRDGWVQAWNVETKKQLPSTIDLNNYFASDGKSLNRDLESADFEEEKSPM 339

  Fly   291 GPQNS--QLRKIS-DQNFCLF----LSHNSRAEFICVSIMPDADD-----------ASV------ 331
            .|..:  .:|..| |.:..|.    |:.:.::..:.|.|:..::|           .||      
 Worm   340 EPTETVYSIRAYSFDVDILLIVGCDLAVSGKSVGMRVHILKVSNDQIQHLQMFETSMSVDERLVD 404

  Fly   332 INLVQNMVPAPQTDLVD-------FDATSSHIWAL-----WSNAEGDFHVSAAYFASNNAIKW-- 382
            :.|:||..|:.:::.:|       ::..::.:::|     .|:|:..:.:....|    ||:|  
 Worm   405 LELIQNYFPSKESESLDETQDGELYNPLTAALFSLSALFKSSSAKKTYSMKRISF----AIQWKK 465

  Fly   383 -------------------------------VSAALEPPPDRYCLTMEQGVDPRETYCSYIFHPG 416
                                           |..|:|.|   |.|:.:..:   ||....:|...
 Worm   466 GRVFTDFDWHSVRQFTSPATTKEEPIGNTDEVEPAIERP---YNLSADSSI---ETLIDVVFDTD 524

  Fly   417 RFDRNVIAKALYMFRRVNLQFDVKQLSMSVLKEQVCQAVEDEIQNELKDFVVTDEEYLEISTRLW 481
            .:..:::.:|:                         |.|.|..:..|..  |.:..:.|:| :|.
 Worm   525 IYPFDIVFRAV-------------------------QIVSDNFRGTLGQ--VRNNNWPELS-KLV 561

  Fly   482 DRFYSCCEQYHIKLSEPTGLAVLGGMDAVCLVRRQS-----FALLRPCEVL-------------- 527
            |.:.:..| ::.|..:.|..::...::|....::.:     :||||.||.|              
 Worm   562 DTYLTSVE-FNRKFQQKTDRSIRLRLNAPQESQKTALKDFWWALLRACEELDFAARGAISLAPIQ 625

  Fly   528 -------------EHLLLIGEHNDEVATYVAPLFRNDPEMAKGFVELMNVVTLLDKLISEDIKIE 579
                         :.:..:|::|.|                  |:|:::         ||:|..:
 Worm   626 FCGDLRIMAVVHRDRMTFLGDNNTE------------------FLEIIS---------SENIPKQ 663

  Fly   580 LDKQLYQRESPVEVISKLVARISMIDDNGPILPSNCVRQIQQKLQNIPNLEPALEMLLDVLCMID 644
            .:.:...|:.|.:....|:...|...|....|    :.:.:.:|.|..|          .:.:::
 Worm   664 GNVEEKFRKLPNKHFIDLIEEASKFADRRVFL----MNRERARLTNAKN----------GVAVVE 714

  Fly   645 PD--EPPHDYSLSTRFLQSSGALMG--------------------------SEYGLSILSETVKQ 681
            .|  |..:||....||:....||.|                          ..:|.|.....|. 
 Worm   715 DDNVENAYDYDSDGRFINIKTALEGPIVKLAAAFVEASTFDNSKPFEDPHPQIFGGSFTQSVVS- 778

  Fly   682 MAMIRFSVCRNLLVLQYMAYGQNEMESENVLTNLNYLNSYYTLVWIAETPISSSTPA-----GFE 741
             |.||.||               |......||....||:      |.|....:..|:     ...
 Worm   779 -ANIRVSV---------------ESRVHFALTLQTLLNA------ITEKKSRAGAPSFGDVEALS 821

  Fly   742 ASIQRLSRAQLFSGYNRPYSSHLKHNGNDQTTLLRLFLESKGLFSALTMLLK------HDSLSLD 800
            ..::.:.|  ::...|......:..||...:....|..:::|    |:|:.|      |....:.
 Worm   822 CELREIIR--VYRELNEQLDIKIVQNGAKMSIGTWLTSDAEG----LSMMKKEGGYGPHGYDEIR 880

  Fly   801 SEQLNLRQSLLQLVGYIN----KMLWPGSPIYVFPEWLFGTCHHIIVQDY---VRILSNWCS--- 855
            ....|      ..||...    :.|...|.|.|.|..|      ::.:.|   :.||:::.|   
 Worm   881 ENDFN------WFVGVTTEAAIRALLSSSEILVLPRRL------VLQKQYKVLLTILNSYISETR 933

  Fly   856 VQKHARRFMLAVSLLDCGEAHKAVHLFHEAESGIVEDDFLFEHVLKNTPLYGKLQNSV-----SR 915
            ..|....|...::........||::.|........|.:             ..|:.:|     .|
 Worm   934 ALKPVITFYRGIAYSGTDHPVKALNSFQSCLDAFSEGN-------------NALRKAVYFLLPKR 985

  Fly   916 GDTISPED--TKLAIVHYYLKVIQLFEQHSALDYIIQLADMAIRVLQPDDPQLPMFQSIVFNNHL 978
            .|....:|  .:|....|:|.|::..::|:..:.:..:|..||..|..::..:.:..:.:||:..
 Worm   986 FDVAQGKDPVEELTASEYFLTVVRFLQEHNHAEEVCSVAVKAIENLPIENESVQLISNTLFNHLT 1050

  Fly   979 QLGHYVEAYTALVNNADISR-RKDCLRQLVITLFQNKC----LPLLMQFSYIGLQDEFESIVE-- 1036
            ....:.::...::.....|. |:..:|:|:..:.  .|    ....|:|.      |.|.:||  
 Worm  1051 NRREWFQSLKLILRTTLRSETRRASIRELLSLML--ACGEWEAIATMKFG------EHEQVVEDF 1107

  Fly  1037 ---SRARSMSIDQNEVYNFLYAFHTNKGNMRKASTVMYEQAMRFQ-VDSDAPNALEKRCSSLLIC 1097
               :..|....::...:..|:||:..:.:.||.:..|||.|...: .....|..|.::...|.:.
 Worm  1108 LRDAACRQSPSEKKHYFELLFAFYVARKDFRKGACAMYEYARHIESTTCMTPELLRRKRDCLAVV 1172

  Fly  1098 LNCLHLV-----DSRYRW---------IAKPVLGDEQVIT------------------------- 1123
            ||...::     |.|..:         ..:|...::::||                         
 Worm  1173 LNLQSVLGMEPDDDRAIYDDATDTNLVFPEPSDDEDELITESDSSGENGKLPSGNKDSGSGTGNN 1237

  Fly  1124 --------------------------------IDQDNDDGEPKCDEDKRG-------QEVVVLEL 1149
                                            .|.|.||.|   |:.|.|       ::::||..
 Worm  1238 SSPDNSNGTSSSGTGVDLVALKARQMAYALGSDDMDTDDTE---DDMKGGSIPLFKRRKLLVLSE 1299

  Fly  1150 ADIRRELVHAEALRELSFYRKDTAAYERATP---EELSYLLASSGLYTAALKLSRGHSFSVLPIF 1211
            .|||.|||...|  .:.....|  .::...|   .||..||..:..:..|..::|..:.....:|
 Worm  1300 KDIRDELVLCSA--RVGLLSSD--QFKGVPPTDLNELFSLLVDNQHFDEAFDIARQFNLDSHRLF 1360

  Fly  1212 ESLTSACV-------------AATEDKSSDAWNWLQNNDMADLPHRSNAADMA-----WTLLQKL 1258
            .::|...:             |||...     .|::.|       |.:.|.:|     |::::.|
 Worm  1361 FTMTREAIMIDALRDDLNIEMAATHQA-----GWVRLN-------RRHCAAVATAEEHWSVVRGL 1413

  Fly  1259 VVDNEAK---DSTLIRKSVVQRLLGLNAFLPQWLINSYKLSHSRELLHLLVKHNRLLEAADLGCE 1320
            |...:|:   ||..:|.| .:..|.....:|.||.:.::.:.:.:.|..||.:    |:..:..:
 Worm  1414 VDAAQAEWPGDSRPLRGS-TEAFLSFKLNVPVWLHSVFENNDANDYLRCLVDY----ESYSIALQ 1473

  Fly  1321 IIAGMLGAGSEYFEFKHAVNIANPQLCFPISTIDLLLHGLKINGKDDLDYEMAYFKLEEE-VQRY 1384
            :::.::  ..|..:    .:.:|.:...|...||.|:    |...|.: .:|:....|:: |...
 Worm  1474 VLSDIV--EQETLQ----ASQSNARTWLPYGIIDELM----IRSADYI-RKMSLKSPEDQVVAAE 1527

  Fly  1385 IETIKRTTDDKM 1396
            :..::::.|.||
 Worm  1528 VANLRKSADQKM 1539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup160NP_001285832.1 Nup160 28..530 CDD:288551 109/657 (17%)
npp-6NP_740844.1 Nup160 43..655 CDD:288551 116/697 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C348837682
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21286
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.