DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup160 and LOC105947166

Sequence 1:NP_001285832.1 Gene:Nup160 FlyBaseID:FBgn0262647 Length:1411 Species:Drosophila melanogaster
Sequence 2:XP_017948775.1 Gene:LOC105947166 ID: Length:1413 Species:Xenopus tropicalis

Alignment Length:1445 Identity:424/1446 (29%)
Similarity:700/1446 (48%) Gaps:125/1446 (9%)


  Fly    11 SYREVI--PRNLSPAEWIEVKINTGTQSTLQDLKTFETSGGYCYKNTKNV--QTRNRFIYWRTYQ 71
            ||.|:|  .|..|...:.::.:.......:...|..:.:|||||..:.::  .||||||:|.:|.
 Frog    22 SYMELIGAERETSRRNFRDLSLRPDVSLVIGGPKYSDCAGGYCYNESGSLLSATRNRFIHWTSYA 86

  Fly    72 DVLELSEVSLDISLQRNHLRLRFTDSAVL--NVSLTEQGTSVTLLVVTVSSVHRYVFPLKVAGQE 134
            |.|||.|:||||:|..|.:||:..:.::|  .|.:.|...::.:|::|..:|||.:.|.......
 Frog    87 DTLELVELSLDINLLNNAVRLKILNCSILPGGVHICETQNNIIVLILTNQTVHRLILPHPSRMYR 151

  Fly   135 GGAASPEDLLSQSIFYDV-NDKINDPSTYYVTDGF-GTMPN--AAVSYLTQDSQSAYFAVAYQSK 195
            ....|...:  ||||.|: ....:||:..||.... |..||  |:.::|:.|.::.:...:....
 Frog   152 SEIISDSHI--QSIFTDIGKTNFHDPNNTYVIPAIPGRAPNSTASTAWLSSDGEALFALPSVSGG 214

  Fly   196 LLLHVM--KCSTGHTITHEIKEPKLMPWFLSN-LKGALTGRSETLEAATSMAFSEIGGEIFILVL 257
            :|:..|  :...|.....|:|:..:|...|:. :..::.|.........|:|...:..:.::..|
 Frog   215 ILVIKMPPRDMEGLVTIAELKQSSVMQRLLTGWMPSSIRGDPGPAHLPVSLAVHTLDHDSYLFAL 279

  Fly   258 YRNNELRLWSVDNLQTVASINCSTELGQDSAAQGPQNSQLRKISDQNFCLFLSHNSRAEFICVSI 322
            .::::||:||..:...:        :..|.....|.:..:|:.:.....|.|:::...|.:.:.:
 Frog   280 CQDHKLRMWSYKDQMCL--------MVADMLEYVPVSKDIRQTAGTGHKLRLAYSDTLEILYLGV 336

  Fly   323 ---MPDADDASVINLV-----------QNMVPAPQTDLVDFDAT--SSHIWALWSNAEGDFHVSA 371
               .|......|..||           .:.:...|..|:||..|  |.:|||||.:.:....:..
 Frog   337 YLHTPRQGQFCVFQLVCTESNRYSLEHTSSIFTNQETLIDFTFTLSSMNIWALWLDDDNQTVMKH 401

  Fly   372 AYFASNNAIKWVSAALEP-PPDRYCLTMEQGVDPRETYCSYIFHPGRFDRNVIAKALYMFRRVNL 435
            ..|..|.|..|....:.| |.|...:..||  :|:|.|...:|.||||....:.||:.:.|:.:.
 Frog   402 INFERNQAGHWNPVFVNPLPDDDLAIGDEQ--EPQEAYLECLFAPGRFTIAALQKAIQILRKGSG 464

  Fly   436 QFDVKQLSMSVLKEQVCQAVEDEIQNELKDFVVTDEEYLEISTRLWDRFYSCCEQYHIKLSEPTG 500
            :  |..||...||::|...||.||||.:.|:.|:.||:.:|:...|.:||:||.||...||.|..
 Frog   465 R--VLDLSWEELKKEVTLTVEKEIQNAVVDYDVSQEEFRQINIENWCKFYTCCLQYQETLSRPLA 527

  Fly   501 LAVLGGMDAVCLVRRQSFALLRPCEVLEHLLLI-GEHNDEVATYVAPLFRNDPEMAKGFVELMNV 564
            |.|....:.|||:|:...:.|.||..:|||.|: |||   :.|....:..:|.:.|...|.|:..
 Frog   528 LVVHPNTNMVCLLRKGFLSFLAPCSSVEHLYLVPGEH---LLTVDESVICDDVDGASDIVSLIQC 589

  Fly   565 VTLLDKLISEDIKIELDKQLYQRESPVEVISKLVARISMIDDNGPILPSNCVRQIQQKLQNIPNL 629
            :.::...|:||:..:::......:||..|..:::..:...|.:      |.:..||.|||:|.|.
 Frog   590 LHMIADYITEDMAYQMESACCHPQSPERVAEQILEDLIANDID------NIMENIQNKLQDIRNP 648

  Fly   630 EPALEMLL---DVLCMIDPDEPPHDYSLSTRFLQSSGALMGSEYGLSILSETVKQMAMIRFSVCR 691
            ..|:..||   |....:|.::..|:..|:.      ..|.||....|::.:.:.:::..||.:||
 Frog   649 IQAISFLLQNMDYETNMDMEQSQHNVRLNL------STLYGSVTASSVVCQAIYKISATRFLICR 707

  Fly   692 NLLVLQYMAYGQNEM-----------ESENVLTNLNYLNSYYTLVWIAETPISSSTPAG-FEASI 744
            :||:||::.....:|           :.|.:......|.|||.:.|.::. ::.:.|.. .|:::
 Frog   708 DLLILQHLLLRLGDMALVGAGQLLHSQQELIPRAAQLLLSYYMIRWGSQC-LACAVPVDLLESNL 771

  Fly   745 QRLSRAQLFSGY--NRPYSSHLKHNGNDQTTLLRLFLESKGLFSALTMLLKHDSLSLDSEQ---- 803
            |.||..:|....  .|.|:|.::       |::.||.|..|. .....:..|..:...|.|    
 Frog   772 QHLSVLELSDSQVEKRRYTSGIQ-------TIVELFFEDVGR-KHFPQVFAHLFIQSGSSQVHRS 828

  Fly   804 LNLRQSLLQLVGYINKMLWPGSPIYVFPEWLFGTCHHIIVQDYVRILSNWCSVQKHARRFMLAVS 868
            ||....:.::..|:.::|||.:|.:.|.|.|...|.:..:|:|||:|..||.|...:..||||..
 Frog   829 LNWADLIHRITSYLLQLLWPSNPNFQFAECLMRNCQYTQLQEYVRLLLPWCQVNVGSCHFMLAQC 893

  Fly   869 LLDCGEAHKAVHLFHEAESGIVEDDFLFEHVLKNTPLYGKLQNSVSRGDTISPEDTKLAIVHYYL 933
            .|..||.|||:..|.:|.|.:..:||| |.:::           |..|:::||.      :.||.
 Frog   894 YLVAGEGHKALDCFSQAASEVEREDFL-EKLIR-----------VEEGESVSPR------LQYYN 940

  Fly   934 KVIQLFEQHSALDYIIQLADMAIRVLQPDDPQLPMFQSIVFNNHLQLGHYVEAYTALVNNADISR 998
            :|::|.|.....:.:||||.:||.....|.......::.:|.:||.:||..:||.||....|.||
 Frog   941 RVLRLLEDVGLPELVIQLATIAISEASDDWRSQAALRTRIFKHHLDMGHNSQAYDALTQIPDTSR 1005

  Fly   999 RKDCLRQLVITLFQNKCLPLLMQFSYIGLQDEFESIVESRARSMSIDQNEVYNFLYAFHTNKGNM 1063
            :.|||||||:.|.:...|..|::|.|:.|.:|...|:|||||::.:..:..|..|||||..:.|.
 Frog  1006 QLDCLRQLVVVLCERSQLQDLVEFPYVNLHNEVVGIIESRARAVDLMTHNYYELLYAFHIYRHNY 1070

  Fly  1064 RKASTVMYEQAMRFQVDSDAPNALEKRCSSLLICLNCLHLVDSRYRWIAKPVLGD--EQVITIDQ 1126
            |||.|||:|..||...:......|:|:.:|.|.|||||.|:...|.||.:||.|.  |:.....:
 Frog  1071 RKAGTVMFEYGMRLGREVRTLRGLQKQVNSYLACLNCLRLIRPEYAWIVQPVSGAVYERPGASPK 1135

  Fly  1127 DNDDGEPKCDEDKRGQEVVVLELADIRRELVHAEALRELSFYRKDTAAYE-RATPEELSYLLASS 1190
            .|.|||......  ..::.:|||.|:.:|.|.|:....|:.:...|||.. .:..||:..||..:
 Frog  1136 RNYDGESSAVPS--SSQIEILELRDLEKEYVLAQTRLTLAKHNPSTAAIAGSSAAEEMVALLVQA 1198

  Fly  1191 GLYTAALKLSRGHSFSVLPIFESLTSACV---AATEDKSSDAWNWLQNNDMADL--PHRSNAADM 1250
            ||:..|:.|.:  :|. | |||.|...|:   ...|...::||.||..|.:|.:  ...|:|.|.
 Frog  1199 GLFDTAISLCQ--TFK-LXIFEGLACKCIRLQQGGEAAQAEAWEWLAANQLATVITTKESSATDQ 1260

  Fly  1251 AWTLLQKLVVDNEAKDSTLIRKSVVQRLLGLNAFLPQWLINSYKLSHSRELLHLLVKHNRLLEAA 1315
            ||.|:...:...|:| :|:....::.:||.....||.||||.||...:.|||.|.:|::.|.|||
 Frog  1261 AWRLMISYLDKYESK-NTMYHHCILNKLLSHGVPLPNWLINRYKAMDAAELLRLYLKYDLLEEAA 1324

  Fly  1316 DLGCEIIAGMLGAGSEYFEFKHAVNIANPQLCFPISTIDLLLHGLKINGKDDLDYEMAYF-KLEE 1379
            :|..|.:..:||.|.:||..:.:.:..:..:.||.|.||.|  .|.:...::..:..|.. ||:.
 Frog  1325 ELVLEYVDALLGKGHQYFGIQVSASATSQLVWFPYSAIDHL--RLALGENENNQHNQAILGKLQR 1387

  Fly  1380 EVQRYIETIKRTTDD 1394
            ::..|.:.:|:.|||
 Frog  1388 KMDEYFQKLKKATDD 1402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup160NP_001285832.1 Nup160 28..530 CDD:288551 146/530 (28%)
LOC105947166XP_017948775.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D284127at2759
OrthoFinder 1 1.000 FOG0003982
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.