DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup160 and LOC100498194

Sequence 1:NP_001285832.1 Gene:Nup160 FlyBaseID:FBgn0262647 Length:1411 Species:Drosophila melanogaster
Sequence 2:XP_004915463.1 Gene:LOC100498194 ID: Length:149 Species:Xenopus tropicalis

Alignment Length:136 Identity:43/137 (31%)
Similarity:72/137 (53%) Gaps:3/137 (2%)


  Fly  1260 VDNEAKDSTLIRKSVVQRLLGLNAFLPQWLINSYKLSHSRELLHLLVKHNRLLEAADLGCEIIAG 1324
            :|.....:|:....::.:||.....||.||||.||...:.|||.|.:|::.|.|||:|..|.:..
 Frog     5 LDKYESKNTMYHHCIINKLLSHGVPLPNWLINRYKAMDAAELLRLYLKYDLLEEAAELVLEYVDA 69

  Fly  1325 MLGAGSEYFEFKHAVNIANPQLCFPISTIDLLLHGLKINGKDDLDYEMAYF-KLEEEVQRYIETI 1388
            :||.|.:||..:..::..:..:.||.|.||.|  .|.:...::..:..|.. ||:.::..|.:.:
 Frog    70 LLGKGHQYFGIQAPLSATSQLVWFPYSAIDHL--RLALGENENNQHNQAILGKLQRKMDEYFQKL 132

  Fly  1389 KRTTDD 1394
            |:.|||
 Frog   133 KKATDD 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup160NP_001285832.1 Nup160 28..530 CDD:288551
LOC100498194XP_004915463.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D284127at2759
OrthoFinder 1 1.000 FOG0003982
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.