DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Csl4 and CSL4

Sequence 1:NP_609492.1 Gene:Csl4 FlyBaseID:FBgn0032346 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_014167.1 Gene:CSL4 SGDID:S000005176 Length:292 Species:Saccharomyces cerevisiae

Alignment Length:294 Identity:75/295 (25%)
Similarity:105/295 (36%) Gaps:123/295 (42%)


  Fly    10 VCLPGERLCRT--------EDSI---VLGIGT----YEQNG----YIYASKSGIVNIEDSGDKCQ 55
            :..||:.:|..        ||.|   |.|.||    ||.||    .|.|:..|.|..|:.....|
Yeast    10 IAYPGKLICPQYGTENKDGEDIIFNYVPGPGTKLIQYEHNGRTLEAITATLVGTVRCEEEKKTDQ 74

  Fly    56 --------------------------------VVSVHKPG--------------FHLTIPATGDV 74
                                            :||| .||              |...:|..||:
Yeast    75 EEEREGTDQSTEEEKSVDASPNDVTRRTVKNILVSV-LPGTEKGRKTNKYANNDFANNLPKEGDI 138

  Fly    75 VTARV--------------------------------LVTTPKFAKCAIFCVRNVL--LESSYRG 105
            |..||                                :|.....:..|.|.|....  |..::||
Yeast   139 VLTRVTRLSLQRANVEILAVEDKPSPIDSGIGSNGSGIVAAGGGSGAATFSVSQASSDLGETFRG 203

  Fly   106 LLRKEDVRETEKDRVDIYKSFRPGDVILARVINQLE-QSFLLTTAENELGVVIA----------Y 159
            ::|.:|||.|::|||.:.:.|:|||::.|:|::..: .::.||||.|:||||.|          |
Yeast   204 IIRSQDVRSTDRDRVKVIECFKPGDIVRAQVLSLGDGTNYYLTTARNDLGVVFARAANGAGGLMY 268

  Fly   160 ASDYRKTRVPMVPVGWSEMQCPQTTIKEPRKVAK 193
            |:|            |..|..|.|...|.||.||
Yeast   269 ATD------------WQMMTSPVTGATEKRKCAK 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Csl4NP_609492.1 Csl4 10..193 CDD:224021 74/293 (25%)
ECR1_N 10..47 CDD:291080 18/56 (32%)
S1_CSL4 66..156 CDD:240217 35/125 (28%)
CSL4NP_014167.1 Csl4 58..292 CDD:224021 60/247 (24%)
EXOSC1 132..237 CDD:287428 27/105 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C193608028
eggNOG 1 0.900 E1_COG1096
Hieranoid 1 1.000
Homologene 1 1.000 H9359
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1914
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004220
OrthoInspector 1 1.000 T1136458
orthoMCL 1 0.900 OOG5_128555
Panther 1 1.100 LDO PTHR12686
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R252
TreeFam 1 0.960
1211.680

Return to query results.
Submit another query.