DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Csl4 and AT5G38890

Sequence 1:NP_609492.1 Gene:Csl4 FlyBaseID:FBgn0032346 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_568559.2 Gene:AT5G38890 AraportID:AT5G38890 Length:191 Species:Arabidopsis thaliana

Alignment Length:194 Identity:75/195 (38%)
Similarity:112/195 (57%) Gaps:14/195 (7%)


  Fly     8 TVVCLPGERLCRTEDSIVLGIGTYEQNGYIYASKSGIVNI----EDSGDKCQVVSV--HKPGFHL 66
            |.:..||:.:.:..: ...|.|.|..:..||||.:|...|    .:|.|:..:|.|  ||.  |.
plant     3 TGLVTPGDVIGKATE-FKAGKGAYVNDATIYASLTGTCRIVSPLPESIDQRAIVEVTGHKA--HG 64

  Fly    67 TIPATGDVVTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRVDIYKSFRPGDV 131
            .||.||.||.|||.....|.|...|.||.:..:..::.|::|::|||.||.|:||:::||..||:
plant    65 PIPETGSVVIARVTKVMTKMAAVDILCVGSKAVRENFAGVIRQQDVRATEIDKVDMHQSFHAGDI 129

  Fly   132 ILARVINQLE-QSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQCPQTTIKEPRKVAKV 194
            :.|.|::..: :::.|:||:||||||.|.::    ....|||:.|:|||||.:...|.||||||
plant   130 VRAMVLSLGDARAYYLSTAKNELGVVSAESA----AGETMVPISWTEMQCPLSGQTEQRKVAKV 189

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Csl4NP_609492.1 Csl4 10..193 CDD:224021 72/190 (38%)
ECR1_N 10..47 CDD:291080 10/37 (27%)
S1_CSL4 66..156 CDD:240217 38/91 (42%)
AT5G38890NP_568559.2 Csl4 4..188 CDD:224021 72/191 (38%)
ECR1_N 5..42 CDD:291080 11/38 (29%)
S1_CSL4 65..155 CDD:240217 38/90 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H9359
Inparanoid 1 1.050 114 1.000 Inparanoid score I1985
OMA 1 1.010
OrthoDB 1 1.010 D1200489at2759
OrthoInspector 1 1.000 T192823
orthoMCL 1 0.900 OOG5_128555
Panther 1 1.100 LDO PTHR12686
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.