DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csl4 and Exosc1

DIOPT Version :9

Sequence 1:NP_609492.1 Gene:Csl4 / 34548 FlyBaseID:FBgn0032346 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_003749167.1 Gene:Exosc1 / 679140 RGDID:1591855 Length:195 Species:Rattus norvegicus


Alignment Length:189 Identity:91/189 - (48%)
Similarity:127/189 - (67%) Gaps:7/189 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLPGERLCRTEDSIVLGIGTYEQNGYIYASKSGIVNIEDSGDKCQVVSVHKPGFHLTIPATGDVV 75
            |:||||||..|:... |.|||.::|||::|.:|.:..........||||.:......:|..|.||
  Rat     8 CIPGERLCNLEEGSP-GSGTYTRHGYIFSSLAGCLTKTSENGALPVVSVMRETESQLLPDVGAVV 71

  Fly    76 TARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRVDIYKSFRPGDVILARVIN-- 138
            |.:|.....:|||..|..|.:..|::::||.:||||:|.||||:|:|||||||||::||:||:  
  Rat    72 TCKVSSINSRFAKVHILYVGSTPLKNAFRGTIRKEDIRATEKDKVEIYKSFRPGDIVLAKVISLG 136

  Fly   139 QLEQSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQCPQTTIKEPRKVAKVLPE 197
            ..:.::||||||||||||:|::    ::.|.|||:.|.|||||:|..||.||||:|.||
  Rat   137 DAQSNYLLTTAENELGVVVAHS----ESGVQMVPISWCEMQCPKTHTKEFRKVARVQPE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Csl4NP_609492.1 Csl4 10..193 CDD:224021 87/183 (48%)
ECR1_N 10..47 CDD:291080 17/35 (49%)
S1_CSL4 66..156 CDD:240217 47/91 (52%)
Exosc1XP_003749167.1 ECR1_N 8..39 CDD:405131 16/31 (52%)
S1_CSL4 62..154 CDD:240217 47/91 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346293
Domainoid 1 1.000 67 1.000 Domainoid score I9643
eggNOG 1 0.900 - - E1_COG1096
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9359
Inparanoid 1 1.050 171 1.000 Inparanoid score I4032
OMA 1 1.010 - - QHG55393
OrthoDB 1 1.010 - - D1200489at2759
OrthoFinder 1 1.000 - - FOG0004386
OrthoInspector 1 1.000 - - oto98834
orthoMCL 1 0.900 - - OOG6_101821
Panther 1 1.100 - - LDO PTHR12686
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4766
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.