DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csl4 and Exosc1

DIOPT Version :9

Sequence 1:NP_609492.1 Gene:Csl4 / 34548 FlyBaseID:FBgn0032346 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_011245614.1 Gene:Exosc1 / 66583 MGIID:1913833 Length:212 Species:Mus musculus


Alignment Length:202 Identity:92/202 - (45%)
Similarity:132/202 - (65%) Gaps:20/202 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLPGERLCRTEDSIVLGIGTYEQNGYIYASKSG-IVNIEDSGD------------KCQVVSVHKP 62
            |:||||||..|:... |.|||.::|||::|.:| ::...::|.            :..||||.:.
Mouse    12 CIPGERLCNLEEGSP-GSGTYTRHGYIFSSLAGCLMKTSENGAVKEAATQRAFPLRVPVVSVMRE 75

  Fly    63 GFHLTIPATGDVVTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRVDIYKSFR 127
            .....:|..|.|||.:|.....:|||..|..|.:..|::::||.:||||:|.||||:|:||||||
Mouse    76 TESQLLPDVGAVVTCKVSSINSRFAKVHILYVGSTPLKNAFRGTIRKEDIRATEKDKVEIYKSFR 140

  Fly   128 PGDVILARVIN--QLEQSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQCPQTTIKEPRK 190
            |||::||:||:  ..:.::||||||||||||:|::    ::.|.|||:.|.|||||:|..||.||
Mouse   141 PGDIVLAKVISLGDAQSNYLLTTAENELGVVVAHS----ESGVQMVPISWCEMQCPKTHTKEFRK 201

  Fly   191 VAKVLPE 197
            ||:|.||
Mouse   202 VARVQPE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Csl4NP_609492.1 Csl4 10..193 CDD:224021 88/196 (45%)
ECR1_N 10..47 CDD:291080 17/36 (47%)
S1_CSL4 66..156 CDD:240217 47/91 (52%)
Exosc1XP_011245614.1 Csl4 14..203 CDD:224021 86/193 (45%)
S1_CSL4 79..171 CDD:240217 47/91 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842824
Domainoid 1 1.000 67 1.000 Domainoid score I9845
eggNOG 1 0.900 - - E1_COG1096
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9359
Inparanoid 1 1.050 170 1.000 Inparanoid score I4129
Isobase 1 0.950 - 0 Normalized mean entropy S1914
OMA 1 1.010 - - QHG55393
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004386
OrthoInspector 1 1.000 - - oto95347
orthoMCL 1 0.900 - - OOG6_101821
Panther 1 1.100 - - LDO PTHR12686
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R252
SonicParanoid 1 1.000 - - X4766
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.