DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Csl4 and Exosc1

Sequence 1:NP_609492.1 Gene:Csl4 FlyBaseID:FBgn0032346 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_011245614.1 Gene:Exosc1 MGIID:1913833 Length:212 Species:Mus musculus

Alignment Length:202 Identity:92/203 (45%)
Similarity:132/203 (65%) Gaps:20/203 (10%)


  Fly    11 CLPGERLCRTEDSIVLGIGTYEQNGYIYASKSG-IVNIEDSGD------------KCQVVSVHKP 62
            |:||||||..|:... |.|||.::|||::|.:| ::...::|.            :..||||.:.
Mouse    12 CIPGERLCNLEEGSP-GSGTYTRHGYIFSSLAGCLMKTSENGAVKEAATQRAFPLRVPVVSVMRE 75

  Fly    63 GFHLTIPATGDVVTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRVDIYKSFR 127
            .....:|..|.|||.:|.....:|||..|..|.:..|::::||.:||||:|.||||:|:||||||
Mouse    76 TESQLLPDVGAVVTCKVSSINSRFAKVHILYVGSTPLKNAFRGTIRKEDIRATEKDKVEIYKSFR 140

  Fly   128 PGDVILARVIN--QLEQSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQCPQTTIKEPRK 190
            |||::||:||:  ..:.::||||||||||||:|::    ::.|.|||:.|.|||||:|..||.||
Mouse   141 PGDIVLAKVISLGDAQSNYLLTTAENELGVVVAHS----ESGVQMVPISWCEMQCPKTHTKEFRK 201

  Fly   191 VAKVLPE 197
            ||:|.||
Mouse   202 VARVQPE 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Csl4NP_609492.1 Csl4 10..193 CDD:224021 89/197 (45%)
ECR1_N 10..47 CDD:291080 17/37 (46%)
S1_CSL4 66..156 CDD:240217 48/92 (52%)
Exosc1XP_011245614.1 ECR1_N 12..43 CDD:291080 16/32 (50%)
Csl4 14..203 CDD:224021 87/194 (45%)
S1_CSL4 79..171 CDD:240217 48/92 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C193598856
eggNOG 1 0.900 E1_COG1096
Hieranoid 1 1.000
Homologene 1 1.000 H9359
Inparanoid 1 1.050 169 1.000 Inparanoid score I4109
Isobase 1 0.950 0 Normalized mean entropy S1914
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004220
OrthoInspector 1 1.000 T1084422
orthoMCL 1 0.900 OOG5_128555
Panther 1 1.100 LDO PTHR12686
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R252
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.