DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Csl4 and exosc1

Sequence 1:NP_609492.1 Gene:Csl4 FlyBaseID:FBgn0032346 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001139039.1 Gene:exosc1 ZFINID:ZDB-GENE-080926-3 Length:194 Species:Danio rerio

Alignment Length:190 Identity:95/191 (50%)
Similarity:132/191 (69%) Gaps:7/191 (4%)


  Fly    10 VCLPGERLCRTEDSIVLGIGTYEQNGYIYASKSGIVNIEDSGDKCQVVSVHKPGFHLTIPATGDV 74
            :|:||||||.|||.|. |.|||.::|||:||.:|.|..::.|::..|:||.:......:|..|.:
Zfish     6 LCVPGERLCSTEDCIP-GTGTYLRHGYIFASLAGYVLRKNEGEELPVISVVRETEAQLLPDVGAI 69

  Fly    75 VTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRVDIYKSFRPGDVILARVIN- 138
            ||.:|....|:|||..|..|.:..|:..:||.:|:||||.||||:|:.||||||||::||:||: 
Zfish    70 VTCKVTSINPRFAKVHILYVGSTPLKDRFRGTIRREDVRATEKDKVETYKSFRPGDIVLAKVISL 134

  Fly   139 -QLEQSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQCPQTTIKEPRKVAKVLPE 197
             .::.::||||||||||||:|::    :....||||.|.|||||:|..||.||||:|.||
Zfish   135 GDVQSNYLLTTAENELGVVVAHS----EAGAQMVPVSWCEMQCPRTHSKEFRKVARVQPE 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Csl4NP_609492.1 Csl4 10..193 CDD:224021 92/185 (50%)
ECR1_N 10..47 CDD:291080 22/37 (59%)
S1_CSL4 66..156 CDD:240217 47/92 (51%)
exosc1NP_001139039.1 Csl4 3..185 CDD:224021 91/184 (49%)
ECR1_N 6..40 CDD:291080 21/35 (60%)
S1_CSL4 61..153 CDD:240217 47/92 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C193596982
eggNOG 1 0.900 E1_COG1096
Hieranoid 1 1.000
Homologene 1 1.000 H9359
Inparanoid 1 1.050 179 1.000 Inparanoid score I3945
OMA 1 1.010
OrthoDB 1 1.010 D1200489at2759
OrthoFinder 1 1.000 FOG0004220
OrthoInspector 1 1.000 T1053609
orthoMCL 1 0.900 OOG5_128555
Panther 1 1.100 LDO PTHR12686
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R252
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.