DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Csl4 and EXOSC1

Sequence 1:NP_609492.1 Gene:Csl4 FlyBaseID:FBgn0032346 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_057130.1 Gene:EXOSC1 HGNCID:17286 Length:195 Species:Homo sapiens

Alignment Length:189 Identity:91/190 (48%)
Similarity:128/190 (67%) Gaps:7/190 (4%)


  Fly    11 CLPGERLCRTEDSIVLGIGTYEQNGYIYASKSGIVNIEDSGDKCQVVSVHKPGFHLTIPATGDVV 75
            |:||||||..|:... |.|||.::|||::|.:|.:..........||||.:......:|..|.:|
Human     8 CIPGERLCNLEEGSP-GSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAIV 71

  Fly    76 TARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRVDIYKSFRPGDVILARVIN-- 138
            |.:|.....:|||..|..|.::.|::|:||.:||||||.||||:|:|||||||||::||:||:  
Human    72 TCKVSSINSRFAKVHILYVGSMPLKNSFRGTIRKEDVRATEKDKVEIYKSFRPGDIVLAKVISLG 136

  Fly   139 QLEQSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQCPQTTIKEPRKVAKVLPE 197
            ..:.::||||||||||||:|::    ::.:.|||:.|.|||||:|..||.||||:|.||
Human   137 DAQSNYLLTTAENELGVVVAHS----ESGIQMVPISWCEMQCPKTHTKEFRKVARVQPE 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Csl4NP_609492.1 Csl4 10..193 CDD:224021 88/184 (48%)
ECR1_N 10..47 CDD:291080 17/36 (47%)
S1_CSL4 66..156 CDD:240217 49/92 (53%)
EXOSC1NP_057130.1 ECR1_N 8..39 CDD:316870 16/32 (50%)
S1_CSL4 62..154 CDD:240217 49/92 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C193598640
eggNOG 1 0.900 E1_COG1096
Hieranoid 1 1.000
Homologene 1 1.000 H9359
Inparanoid 1 1.050 170 1.000 Inparanoid score I4051
Isobase 1 0.950 0 Normalized mean entropy S1914
OMA 1 1.010
OrthoDB 1 1.010 D1200489at2759
OrthoFinder 1 1.000 FOG0004220
OrthoInspector 1 1.000 T1074327
orthoMCL 1 0.900 OOG5_128555
Panther 1 1.100 LDO PTHR12686
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R252
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.