DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Csl4 and csl4

Sequence 1:NP_609492.1 Gene:Csl4 FlyBaseID:FBgn0032346 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_588510.1 Gene:csl4 PomBaseID:SPCC1840.11 Length:181 Species:Schizosaccharomyces pombe

Alignment Length:188 Identity:65/189 (34%)
Similarity:102/189 (54%) Gaps:13/189 (7%)


  Fly    12 LPGERLCRTEDSIVLGIGTYEQNGYIYASKSGIVNIEDSGDKCQVVSVHKPGFHLTIPATGDVVT 76
            |||:.:.|...:   |.||.::..||.::::||.:.|    |..|....|......:|..|.:|.
pombe     5 LPGQVVARGAPN---GEGTVKRGDYIISTRTGIFDPE----KNSVTYPRKVEETAVLPNVGSIVL 62

  Fly    77 ARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRVDIYKSFRPGDVILARVINQLE 141
            |||.....:.|...|..|.:|..:..::|::..:|:|.|||::|.:..||||||::.|.||:..:
pombe    63 ARVSRINARQATVNISVVDDVCTKDEFQGVIHVQDIRATEKNKVKVQNSFRPGDIVRALVISLGD 127

  Fly   142 -QSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQCPQTTIKEPRKVAK-VLPE 197
             .|:.||||.|:|||:.|.:|:   |...|.||.:..|| .::...|.||.|| :|.|
pombe   128 GSSYFLTTARNDLGVIFAQSSE---TGEQMFPVDYQHMQ-TKSGYTEMRKCAKPILDE 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Csl4NP_609492.1 Csl4 10..193 CDD:224021 62/182 (34%)
ECR1_N 10..47 CDD:291080 11/35 (31%)
S1_CSL4 66..156 CDD:240217 35/91 (38%)
csl4NP_588510.1 Csl4 1..181 CDD:224021 64/187 (34%)
S1_CSL4 53..143 CDD:240217 35/90 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H9359
Inparanoid 1 1.050 89 1.000 Inparanoid score I1733
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004220
OrthoInspector 1 1.000 T1125398
orthoMCL 1 0.900 OOG5_128555
Panther 1 1.100 LDO PTHR12686
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R252
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.