DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Csl4 and exos-1

Sequence 1:NP_609492.1 Gene:Csl4 FlyBaseID:FBgn0032346 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_499416.1 Gene:exos-1 WormBaseID:WBGene00012966 Length:208 Species:Caenorhabditis elegans

Alignment Length:209 Identity:71/210 (34%)
Similarity:111/210 (53%) Gaps:20/210 (10%)


  Fly     7 ETVVCLPGERLCRTEDSIVLGIGTYEQNGYIYASKSGIVNIEDSGDK----CQVVSVHKPGFHL- 66
            ||:|. ||:::........:|.|.||.|..|:||.:|.||:....||    .||:.|.:....| 
 Worm     4 ETLVA-PGDKVLDAIGEYRMGKGLYEANRRIFASVAGFVNVYGFRDKSDNLVQVIEVRRSEDQLD 67

  Fly    67 --TIPATGDVVTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRVDIYKSF-RP 128
              .:|..|.:|||:|:....:||||.|..:.:.:.:..:..||.|:.:|..|.:..:.:|:| ||
 Worm    68 NELLPFHGAIVTAKVMAVGLRFAKCDIISIGDKVYKKRFSALLPKKKLRPLEPELSEPFKNFVRP 132

  Fly   129 GDVILARVIN--QLEQSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQCPQTTIKEPRKV 191
            .|.|||:|..  :::..|:|:.||:|||||:...    :...||..|.|:.:...:|...||||:
 Worm   133 NDYILAKVCEDAEIKDKFVLSIAEDELGVVLCRG----RFGEPMQKVDWNTVVSTRTGKTEPRKM 193

  Fly   192 AKV-----LPESSI 200
            |||     ||..|:
 Worm   194 AKVPQKCTLPTQSV 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Csl4NP_609492.1 Csl4 10..193 CDD:224021 64/193 (33%)
ECR1_N 10..47 CDD:291080 14/37 (38%)
S1_CSL4 66..156 CDD:240217 34/96 (35%)
exos-1NP_499416.1 Csl4 5..195 CDD:224021 65/195 (33%)
ECR1_N 6..43 CDD:291080 14/38 (37%)
S1_like 70..162 CDD:299122 33/92 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C193302228
eggNOG 1 0.900 E1_COG1096
Hieranoid 1 1.000
Homologene 1 1.000 H9359
Inparanoid 1 1.050 96 1.000 Inparanoid score I3580
Isobase 1 0.950 0 Normalized mean entropy S1914
OMA 1 1.010
OrthoDB 1 1.010 D1200489at2759
OrthoFinder 1 1.000 FOG0004220
OrthoInspector 1 1.000 T474741
orthoMCL 1 0.900 OOG5_128555
Panther 1 1.100 LDO PTHR12686
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R252
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.