DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Csl4 and exosc1

Sequence 1:NP_609492.1 Gene:Csl4 FlyBaseID:FBgn0032346 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001123851.1 Gene:exosc1 XenbaseID:XB-GENE-1007857 Length:194 Species:Xenopus tropicalis

Alignment Length:190 Identity:92/191 (48%)
Similarity:131/191 (69%) Gaps:9/191 (5%)


  Fly    11 CLPGERLCRTEDSIVLGIGTYEQNGYIYASKSG-IVNIEDSGDKCQVVSVHKPGFHLTIPATGDV 74
            |:||||||.||| ...|.||:.::|||:||.:| ||...|:|....:..|.:...|| :|..|.|
 Frog     7 CVPGERLCSTED-CAPGYGTFCRHGYIFASLAGYIVKKTDNGLMPVISVVRETDSHL-LPDVGSV 69

  Fly    75 VTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRVDIYKSFRPGDVILARVIN- 138
            ||.:|.....:|||..|..:.:..|.:::||.:||||:|.||||:|::||||||||:::|:||: 
 Frog    70 VTCKVTSINSRFAKVQIMYIGSTPLSNTFRGTIRKEDIRATEKDKVEVYKSFRPGDIVMAKVISL 134

  Fly   139 -QLEQSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQCPQTTIKEPRKVAKVLPE 197
             .::.::||:|||||||||:|::    :....|||:.|.|||||:|.|||.||||:|.||
 Frog   135 GDIQSNYLLSTAENELGVVVAHS----EAGATMVPISWCEMQCPKTHIKEQRKVARVQPE 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Csl4NP_609492.1 Csl4 10..193 CDD:224021 89/185 (48%)
ECR1_N 10..47 CDD:291080 21/37 (57%)
S1_CSL4 66..156 CDD:240217 45/92 (49%)
exosc1NP_001123851.1 ECR1_N 7..40 CDD:291080 19/34 (56%)
Csl4 9..185 CDD:224021 87/182 (48%)
S1_CSL4 61..153 CDD:240217 46/93 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C193596876
eggNOG 1 0.900 E1_COG1096
Hieranoid 1 1.000
Homologene 1 1.000 H9359
Inparanoid 1 1.050 172 1.000 Inparanoid score I3885
OMA 1 1.010
OrthoDB 1 1.010 D1200489at2759
OrthoFinder 1 1.000 FOG0004220
OrthoInspector 1 1.000 T1060401
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R252
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.