DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)gd1 and cc2d1b

Sequence 1:NP_001245976.1 Gene:l(2)gd1 FlyBaseID:FBgn0261983 Length:834 Species:Drosophila melanogaster
Sequence 2:XP_004914063.1 Gene:cc2d1b XenbaseID:XB-GENE-997988 Length:861 Species:Xenopus tropicalis

Alignment Length:868 Identity:290/869 (33%)
Similarity:460/869 (53%) Gaps:102/869 (12%)


  Fly    28 DFDPS---AGYGEDDGGDSDLEAELAAITGGEGA-KPKPKPKAKLLPASDLDKMIADSLRDVSDD 88
            ||.|.   .|. .||..|.||||||||:||.:.| |||||.||. ||..|::||..|.::|...:
 Frog    29 DFSPEDMMLGI-PDDPDDGDLEAELAALTGVKAASKPKPKGKAP-LPMEDIEKMAQDCMKDTIGE 91

  Fly    89 DDDDNLESDPDLLGELSGIGGLEEAEEEEPVAQPPAASEEP------------------VQTFLP 135
            |||::||.|.:||.||..:.|.:|.||.|.:....|...||                  :|..|.
 Frog    92 DDDEDLEGDEELLAELQEVVGDDEEEEMEQLRPSNAEELEPPLPDILESGQQVNSSATEIQHHLQ 156

  Fly   136 TTTVDTLSIIKQRLEMYKQAEANAKTAGDSGKARRFGRGLKTLKDLHRQAAAGKSINVDDIPPEV 200
            ........::::|:..||:|.:|||.:.:|.||||:.||||||:.:......|:::...||||.|
 Frog   157 APAEGMFQVLEERIRNYKEAISNAKLSNESAKARRYERGLKTLESMLHTVKQGRAVIEADIPPPV 221

  Fly   201 SV-KPIGGQAPPVPAEES-----------PAPSTPA------SPPPVPSRAAPDPPTPGTPVEPT 247
            :. ||.......||..::           |..:|.|      |..||......|    |..|:.|
 Frog   222 ACGKPAVSPKTDVPTTDTSKEEVEDLNHVPMETTEAATNLDSSEDPVSKAITND----GGAVDKT 282

  Fly   248 TSVAPTSPPNPLVTQMRSRQTDYKAAALQSKRSGDISTALQFLKVVKQFDVVIKMCEDGQEVDLS 312
            .. ||.:..:| .|.:..||.:||.|||:||::|:|..|.:::::.|:|.||::..|.||.||||
 Frog   283 HG-APQNDTDP-KTLLLQRQREYKLAALKSKQTGNIEKAKEYMRISKKFSVVLEALESGQPVDLS 345

  Fly   313 DMPPPPAEFLEFLKKMQEEAAAEAVAEPTAAPEPTPVAPAPVLAAATNMLEALQQRLEKYQSVEA 377
            :||..|.:....:.:      ::..|.||.|| |.||:....|:|. ::|:|||||:|||:|...
 Frog   346 NMPAAPEDHDTMVTE------SKIPAHPTPAP-PVPVSNTQGLSAG-SLLQALQQRMEKYKSAAQ 402

  Fly   378 AAKAENNSGKARRFGRIVKQYEDAIKLYKAGKPVPYDELPVPPGFGPLPTADAAPVAPTPSLPTS 442
            .||:..:..|||...||.|||:|||:.:|||:.|...||||||||.|||..:  ......|:..:
 Frog   403 QAKSSGDDRKARMHERIAKQYQDAIRAHKAGRQVNLAELPVPPGFPPLPGME--QTEEEGSVEKA 465

  Fly   443 PTSPPPTASTSAGGTPSSSSATTPTAPRKAPSPPKPKELT-------------------TRTSGN 488
            ..:....|.| ||...............:.|..|||.:|.                   .:|:..
 Frog   466 LEAAQKLAKT-AGNEEDDDDGEEGECQARPPGHPKPTQLVKPMPAVSDSEETSLTNKAPVKTASE 529

  Fly   489 QQKNNIAEQQMKLLLERQKEFKLAAIEAKKAGEIDQAKEYLKIFKGFDSLLNAASSGLPVDLSTL 553
            .:.....::|::.|..|:|:::.||::||:..:::|||:::::.......::...||..||:|.:
 Frog   530 GKLPPAVQEQLEFLEHRKKQYRKAALQAKQKNDLEQAKQHMRVAHTLQVSIDQVRSGKLVDISKV 594

  Fly   554 PVPPSQRDNLEASFAIVSAEECDPTDDICEIGVRMEEQLAKQLMMCKNTRDHHKAMGDVAGMNRF 618
            |..|   |:.|:.|.:|..|:.....:..::...:.:.|.:|...|.........||:||...||
 Frog   595 PSLP---DDEESDFVVVEHEDIKTPQNSEDVYSMLLKLLHEQHEKCIRYSKQFTQMGNVAETTRF 656

  Fly   619 ENLALTVQKDLDLVRYSKRKNEPLPKFHYEKRSFNIVHCNTDLTDSELEIVVVRGISYNVAN--- 680
            |.:|...:|:.::::.|:.:....|.:|:|.::..||...::|:.:|:.:::||||:....:   
 Frog   657 EKMAEDCKKNCEILQLSQAQGLDPPPYHFEDKTLKIVRVFSELSSTEMLLIIVRGINLPAPSGVA 721

  Fly   681 PKDVDTYVRVEFPLLNDES-FKTKTNVIRDTSSPDYDERFKVDIQRTNRQFQRIFKRHGVKFEIY 744
            |.|:|.||:.|||..:.|. .|.||.||::|:||:|:..||::|.|.:|.|:|:.:..|:||||:
 Frog   722 PNDLDAYVKFEFPYPSSEQPQKNKTLVIKNTNSPEYEHSFKLNINRNHRGFKRVIQTKGIKFEIF 786

  Fly   745 SRGCSIDCCGLSRKLPLCCFRGFLRSDTLIGTVNVKLQPLETKCEIHDTYDLMDGRKQVGGKLEV 809
            .:|..:                 :|||..:||.:|||..|||:|||.:..::.||||..|||||:
 Frog   787 HKGFFL-----------------VRSDKQVGTASVKLDKLETQCEIREIVEVFDGRKPTGGKLEI 834

  Fly   810 KIRVRNPILTKQMEHITEKWLVL 832
            |:|:|:|:..:.::.:||||||:
 Frog   835 KVRLRDPLNGQDLQVVTEKWLVM 857

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)gd1NP_001245976.1 DM14 142..200 CDD:128928 23/58 (40%)
DM14 260..318 CDD:128928 26/58 (45%)
DM14 362..420 CDD:128928 32/58 (55%)
DM14 499..557 CDD:128928 16/58 (28%)
C2_Freud-1 661..832 CDD:176072 70/175 (40%)
cc2d1bXP_004914063.1 DM14 166..221 CDD:128928 23/55 (42%)
DM14 294..351 CDD:128928 26/57 (46%)
DM14 387..440 CDD:128928 27/53 (51%)
DM14 540..598 CDD:128928 16/58 (28%)
C2_Freud-1 699..857 CDD:176072 70/175 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280267278
eggNOG 1 0.900 E1_KOG3837
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D408012at33208
OrthoFinder 1 1.000 FOG0002211
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.