DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reps and REPS2

Sequence 1:NP_609487.2 Gene:Reps FlyBaseID:FBgn0032341 Length:907 Species:Drosophila melanogaster
Sequence 2:XP_011543905.1 Gene:REPS2 HGNCID:9963 Length:663 Species:Homo sapiens

Alignment Length:913 Identity:220/914 (24%)
Similarity:319/914 (35%) Gaps:343/914 (38%)


  Fly     5 LTEPETRFYSELFQCC----------DVEKTGKVPMLKAT-------ELFRSADIANETVIEITG 52
            |:|.|.:.|||||..|          ...:..:|....||       :|||::.:..||:.:||.
Human    30 LSEGEQQCYSELFARCAGAAGGGPGSGPPEAARVAPGTATAAAGPVADLFRASQLPAETLHQITE 94

  Fly    53 LAGIPSTALHISRTQFYSCLKLIAAHQAAMPLRQELILATFPLPLPHFSWK----EAVTAPVAVE 113
            |.|..... :...||||..||||||.|:.:|:|.|.|..  .||||.|...    |......|..
Human    95 LCGAKRVG-YFGPTQFYIALKLIAAAQSGLPVRIESIKC--ELPLPRFMMSKNDGEIRFGNPAEL 156

  Fly   114 NGLTALPPPPPTDRRNSLRRNSQQEQLQDT-----SDVPSTDSEVEQNESVDDATGHGRGTDGCG 173
            :| |.:..|..|..:||.:|...:::.|:|     |.:.|..|.....:.|..:.|:.:      
Human   157 HG-TKVQIPYLTTEKNSFKRMDDEDKQQETQSPTMSPLASPPSSPPHYQRVPLSHGYSK------ 214

  Fly   174 VVSSSSRENVGRRRGGGTGGGSPEAWSTNSDSPTPTNSVAERPWAQDTLWQGLLGDEHRQLLGTE 238
              ..||.|.:           .|..:........|..|.:..|..:....|..|    .:....|
Human   215 --LRSSAEQM-----------HPAPYEARQPLVQPEGSSSGGPGTKPLRHQASL----IRSFSVE 262

  Fly   239 EESSDRHSSDDDDNESELVTIYQITPEQREYYNKQFRTVQRDPHGLLSGQAARNFFEKSRIPVEE 303
            .|..|..|..|:.        ::||.||||||..|||::|.||...:||..|:|||.||::.:.|
Human   263 RELQDNSSYPDEP--------WRITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPE 319

  Fly   304 LRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAAASGSGQGVTSSS 368
            |.:||:|.|...||||:|.||.||.||:|.|:|..|||..||..|.|..||              
Human   320 LSYIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLPPTLQPEYLQ-------------- 370

  Fly   369 SAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSGSSTTSKPRPNVPSDKNIMNLSSISTSSQA 433
             ||.|:  |:.|.                   .|..|.:.|.|....|.|.|.|..:|:      
Human   371 -AAFPK--PKWDC-------------------QLFDSYSESLPANQQPRDLNRMEKTSV------ 407

  Fly   434 SNSSKREATPQNSLGKNRSISNSPNVEKPVSGTVSSTASAVDSTNVSSQWTKFSESPTTSAVSVQ 498
                           |:.:....||                                        
Human   408 ---------------KDMADLPVPN---------------------------------------- 417

  Fly   499 STTGAAPVVAAGAAASGASSPGLKPVLFDMKRSAQDVVSNPQILHPVPLRVTPIGTAIASSAESS 563
                                              |||.|:.:                  .|..|
Human   418 ----------------------------------QDVTSDDK------------------QALKS 430

  Fly   564 NENESAVAQREDSPKAISSTTVNNQSSAVVPGISGVAGSSHRDSSDLRAIQRPQAKKLPAKNSAL 628
            ..||:.       ||.:|...                 ::.:||:.|:|  ||:::         
Human   431 TINEAL-------PKDVSEDP-----------------ATPKDSNSLKA--RPRSR--------- 460

  Fly   629 PPPPQREPSIGSTGPSESQEPQAAYVASSLASKKEPPPLPPPRPHR-HARSSSLDLNKFKIGATG 692
                    |..||...|:.:            :.|.||.|||||.: |:|:|||||||       
Human   461 --------SYSSTSIEEAMK------------RGEDPPTPPPRPQKTHSRASSLDLNK------- 498

  Fly   693 GAQQAEITAQASFDMQTSTGFADFTHFADEGAANVVDEQQLHSLPPAAPP----------PQAAV 747
             ..|..:.|       |.:|                    |...|||.||          .:|.:
Human   499 -VFQPSVPA-------TKSG--------------------LLPPPPALPPRPCPSQSEQVSEAEL 535

  Fly   748 VPP-TRITLQQAQQRVSAFEV-YRKPQT--------PRGSQSPPQQPPPPA--PAVGLTTQTGQL 800
            :|. :|...|.|:...:..:| |.:|.:        |....:..|:|...|  ||          
Human   536 LPQLSRAPSQAAESSPAKKDVLYSQPPSKPIRRKFRPENQATENQEPSTAASGPA---------- 590

  Fly   801 PSAESFEKRVTAISDSLRHVSFKQGQANTTEVLQRLREQNNSLLHLCNDLSDELLSVQTR---KE 862
             ||.:.:...|     ::..|.||.:|..| .:::.:|.|..|..|.::|..:|.:..||   :|
Human   591 -SAATMKPHPT-----VQKQSSKQKKAIQT-AIRKNKEANAVLARLNSELQQQLKAAGTRAHSQE 648

  Fly   863 EMR 865
            |.|
Human   649 EGR 651

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RepsNP_609487.2 EH 262..345 CDD:197477 46/83 (55%)
EH 270..336 CDD:238009 34/66 (52%)
REPS2XP_011543905.1 EFh <75..121 CDD:298682 20/47 (43%)
EH 275..370 CDD:197477 50/103 (49%)
EH 286..352 CDD:238009 34/66 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1955
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3811
Isobase 1 0.950 0 Normalized mean entropy S6242
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D116563at33208
OrthoFinder 1 1.000 FOG0001693
OrthoInspector 1 1.000 T609385
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11216
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5227
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.