DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reps and EDE1

Sequence 1:NP_609487.2 Gene:Reps FlyBaseID:FBgn0032341 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_009506.1 Gene:EDE1 SGDID:S000000143 Length:1381 Species:Saccharomyces cerevisiae

Alignment Length:1008 Identity:195/1009 (19%)
Similarity:356/1009 (35%) Gaps:235/1009 (23%)


  Fly     5 LTEPETRFYSELFQCCDVEKTGKVPMLKATELFRSADIANETVIEITGLAGIPSTALHISRTQFY 69
            |:..|..||::.|...|.|..|.|.......||.|:.:..:.:.::.....|.:... ::..:|.
Yeast    10 LSSQEQAFYNQKFHQLDTEDLGVVTGEAVRPLFASSGLPGQLLSQVWATVDIDNKGF-LNLNEFS 73

  Fly    70 SCLKLIAAHQAA--MPLRQELILATFPLPLPHFSWKEAVTAPVAVENGLTALPPPPPTDRRNSLR 132
            :.|::||..|.|  .|:...|..:| |..|..||..:   .|..:::|              |..
Yeast    74 AALRMIAQLQNAPNQPISAALYEST-PTQLASFSINQ---NPAPMQSG--------------SAT 120

  Fly   133 RNSQQEQLQDTSDVPSTDS-EVEQNESVDDATGHGRGTDGCGVVSSSSRENV--GRRRGGGTGGG 194
            .|:      :.:|:|:..| ::.:...:.|.|..|..|     |:....:::  ..|....|.| 
Yeast   121 GNT------NNTDIPALSSNDIAKFSQLFDRTAKGAQT-----VAGDKAKDIFLKARLPNQTLG- 173

  Fly   195 SPEAW---------------------------STNSDSPTPTNSVAERPWAQDTLWQGLLGDEHR 232
              |.|                           |.:....||...:..:.|....|...::...:|
Yeast   174 --EIWALCDRDASGVLDKSEFIMAMYLIQLCMSHHPSMNTPPAVLPTQLWDSIRLEPVVVNQPNR 236

  Fly   233 ----QLLGTEEESSDRHSSDDDDNE---SELVTIYQITPEQREYYNKQFRTVQRDPHGLLSGQAA 290
                ....|...|..|||:....:.   |...:.:.::.|:::.::..|.::.:...|.||....
Yeast   237 TTPLSANSTGVSSLTRHSTISRLSTGAFSNAASDWSLSFEKKQQFDAIFDSLDKQHAGSLSSAVL 301

  Fly   291 RNFFEKSRIPVEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCL------- 348
            ..||..||:..|.|..||.|.|:..:...:..||..||.|:..:...:.||..:|:.|       
Yeast   302 VPFFLSSRLNQETLATIWDLADIHNNAEFTKLEFAIAMFLIQKKNAGVELPDVIPNELLQSPALG 366

  Fly   349 --HPNVLQAAASGSGQGVTSSSS-------------------AALPQEPPE-------ADLLHLN 385
              .||.|....|.....:.|.:|                   ..:||..|:       .|||.||
Yeast   367 LYPPNPLPQQQSAPQIAIPSRASKPSLQDMPHQVSAPAVNTQPTVPQVLPQNSNNGSLNDLLALN 431

  Fly   386 DDDE-----------DDHTDNTIIAGNLSGSSTTSKPRPNVP-----SDKNIMNLSSISTSSQAS 434
            ....           .::|:|:....|.:|.:|..:.:|..|     |...:...:..|...|:.
Yeast   432 PSFSSPSPTKAQTVVQNNTNNSFSYDNNNGQATLQQQQPQQPPPLTHSSSGLKKFTPTSNFGQSI 496

  Fly   435 NSSKREATPQNSLGKNRSISNSPNVEK----PVSGTVSSTASAVDSTNVSSQWTKFSESPTTSAV 495
            ...:.|...|.....:...:..|.|.|    ||..|.|:|...|.:.:|.|.       |..:|.
Yeast   497 IKEEPEEQEQLRESSDTFSAQPPPVPKHASSPVKRTASTTLPQVPNFSVFSM-------PAGAAT 554

  Fly   496 SVQSTTGAAPVVAAGAAASGASSPGLKPVLFDMKRSAQDVVSNPQILHPVPLRVTPIGTAIASSA 560
            |  :.||||...|.||||.|||                                     |.:.|:
Yeast   555 S--AATGAAVGAAVGAAALGAS-------------------------------------AFSRSS 580

  Fly   561 ESSNENESAVAQREDSPKAISSTT----VNNQSSAVVPGISGVAGSSHRDSSDLRAIQRPQAK-- 619
            .::.:|:...|..|.|.:..::||    ::||.:::....|.......|.:.:|:.:...:..  
Yeast   581 NNAFKNQDLFADGEASAQLSNATTEMANLSNQVNSLSKQASITNDKKSRATQELKRVTEMKNSIQ 645

  Fly   620 -KLPAKNSALPPPPQREPSIGSTGPSESQEPQAAYVASSLASKKEPPPLPPPRPHRHARSSSL-- 681
             ||....|.      .:.::..|...|:|..|......:||.:     |.....:.||..|.|  
Yeast   646 IKLNNLRST------HDQNVKQTEQLEAQVLQVNKENETLAQQ-----LAVSEANYHAAESKLNE 699

  Fly   682 ---DLNKFKIGATGGAQQAEITAQASFDMQTSTGFADFTHFADEGAANVVDEQQLHSLPPAAPPP 743
               ||.:.:      .:.||:..|.: ::.:.|  |......:|....|..|:.:..:       
Yeast   700 LTTDLQESQ------TKNAELKEQIT-NLNSMT--ASLQSQLNEKQQQVKQERSMVDV------- 748

  Fly   744 QAAVVPPTRITLQQAQ-------QRVSAFEVYRKPQTPRGSQSPPQQPPPPAPAVGLTTQTGQLP 801
            .:..:...::|:...|       :::|.:...:|...........|.....|....|:.:...|.
Yeast   749 NSKQLELNQVTVANLQKEIDGLGEKISVYLTKQKELNDYQKTVEEQHAQLQAKYQDLSNKDTDLT 813

  Fly   802 SAE-SFEKRVTAISDS----LRHVS--------FKQGQANTTEVLQRLREQNNSLLHLCNDLSDE 853
            ..| ..|:|...|.:.    .:|||        ..|.:|:..:..|.|:|:|....:...:||:.
Yeast   814 DREKQLEERNRQIEEQENLYHQHVSKLQEMFDDLSQRKASFEKADQELKERNIEYANNVRELSER 878

  Fly   854 LLSV---QTRKEEMRLKLEGLNASDSTGRTSSS 883
            .:::   |..::...:..:..:.:|:|.:.::|
Yeast   879 QMNLAMGQLPEDAKDIIAKSASNTDTTTKEATS 911

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RepsNP_609487.2 EH 262..345 CDD:197477 22/83 (27%)
EH 270..336 CDD:238009 19/66 (29%)
EDE1NP_009506.1 UBA_scEDE1_like 1345..1379 CDD:270471
EH 9..101 CDD:197477 23/93 (25%)
EH 128..221 CDD:197477 15/101 (15%)
EH 270..363 CDD:197477 24/93 (26%)
SMC_N <595..877 CDD:330553 55/309 (18%)
COG3942 903..>1111 CDD:332523 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11216
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.