DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reps and AT1G20760

Sequence 1:NP_609487.2 Gene:Reps FlyBaseID:FBgn0032341 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_173499.1 Gene:AT1G20760 AraportID:AT1G20760 Length:1019 Species:Arabidopsis thaliana

Alignment Length:619 Identity:135/620 (22%)
Similarity:208/620 (34%) Gaps:210/620 (34%)


  Fly     8 PETRFYSELFQCCDVEKTGKVPMLKATELFRSADIANETVIEITGLAGIPSTALHISRTQFYSCL 72
            |....:...|:..|::..|::...:|...|:.:.::.:.:.:|..|:. .|.:..:.|..||:.|
plant     6 PNMDQFEAYFKRADLDGDGRISGAEAVGFFQGSGLSKQVLAQIWSLSD-RSHSGFLDRQNFYNSL 69

  Fly    73 KLIAAHQAAMPLRQELI------------------LATFPLPLPHFSWKEAVT-----------A 108
            :|:...|:...|..|::                  |:..|.|.|:   ..|.|           |
plant    70 RLVTVAQSKRDLTPEIVNAALNTPAAAKIPPPKINLSAIPAPRPN---PAATTVGPVSGFGGPGA 131

  Fly   109 PVAVEN-------------------GLTAL-PPPPPTDRRNSLRRNSQQEQLQDTSDVPSTDSEV 153
            |.|:.|                   |||:| |...|..|.::|   |.|.|......|......|
plant   132 PNAIVNQNYFPPQQNQQMRPNQGISGLTSLRPAAGPEYRPSAL---SGQFQPVPVGSVTHPPQPV 193

  Fly   154 EQNESVDDATGHGRGT-------DGCGVVSSSSRENVGRRRGGGTGGGS---------------P 196
            ..:.|     |.|..|       .|.|..|..|         .|.||||               |
plant   194 PTSVS-----GPGSSTFNLNSLYAGAGNTSGYS---------SGFGGGSLAAPSPGLKQESHIDP 244

  Fly   197 EAWSTNSD------------SPTPTNSVAE--------------RPWAQDTLWQ--GLL--GDEH 231
            :|...:.:            .||.:||...              :|.|.|:|..  .:|  |::.
plant   245 KALVVSGNGGDMFSSFQQKQEPTLSNSSISSAIVPTSAGIQPPTKPNALDSLQSTFSMLPSGNQL 309

  Fly   232 RQ---------LLGTEEESS---------DRHSSDDDDNESELVTIYQITPEQREYYNKQFRTVQ 278
            :|         .:.::..||         ..||:...:|:....   ::.|...:.|.|.|..|.
plant   310 QQPRPAASSQPAVSSQGPSSGLPPGSAVGSGHSTPAGNNQPPWP---KMKPSDVQKYTKVFMEVD 371

  Fly   279 RDPHGLLSGQAARNFFEKSRIPVEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTS 343
            .|..|.::|:.|||.|...|:|.|.|:|:|:|.|...|..|||.||..:::|:...|...||||:
plant   372 SDKDGKITGEQARNLFLSWRLPREVLKHVWELSDQDNDTMLSLREFCISLYLMERYREGRPLPTA 436

  Fly   344 LPHCL----------------HPNVLQAAASGSGQG-VTSSSSAALPQEPPEADLLHLNDDDEDD 391
            ||..:                :.|    |..||||| |......|.|..|               
plant   437 LPSSIMFDETLLSISGAPSHGYAN----AGWGSGQGFVQQPGMGARPITP--------------- 482

  Fly   392 HTDNTIIAGNLSGSSTTSKPRPNVPSDKNIMNLSSISTSSQASNSSKREATPQNSLGKNRSI-SN 455
                            |:..||.||: ......|.|..:...:.:...:|...|.||...|. ||
plant   483 ----------------TTGMRPPVPA-PGPQPGSGIPPNQPRNQAPVLDAPFANHLGNGYSASSN 530

  Fly   456 SPNVEKPVSGTVSSTASAVDSTNVSSQWTKFSES 489
            .|.             :|.|...|..:...:.:|
plant   531 LPE-------------AAADEEKVDEKQNAYMDS 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RepsNP_609487.2 EH 262..345 CDD:197477 33/83 (40%)
EH 270..336 CDD:238009 27/66 (41%)
AT1G20760NP_173499.1 EH 11..77 CDD:238009 14/67 (21%)
EH 351..441 CDD:197477 34/93 (37%)
EH 363..429 CDD:238009 27/66 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124548
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11216
Phylome 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.