DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reps and pan1

Sequence 1:NP_609487.2 Gene:Reps FlyBaseID:FBgn0032341 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_001342822.1 Gene:pan1 PomBaseID:SPAC25G10.09c Length:1794 Species:Schizosaccharomyces pombe

Alignment Length:852 Identity:167/853 (20%)
Similarity:270/853 (32%) Gaps:286/853 (34%)


  Fly   206 PTPTNSVAERPWAQDTLWQGLLGDEHRQLLGTE---EESSDRHSSDDDDN--ESELVTIYQITPE 265
            |..|..:|.:|......| |.:......|.|.|   ::......|...:|  :.:....:.|:.|
pombe   757 PQRTGGMAPQPTGMPGQW-GFINTPLSNLPGIEALGQQMMPNAPSGGLNNTFQQKKDIPWAISKE 820

  Fly   266 QREYYNKQFRTVQRDPHGLLSGQAARNFFEKSRIPVEELRHIWQLCDVTRDGALSLSEFTAAMHL 330
            ::..|::.|....::..|.|.|.|....|.:|::...||.|||.|||....|:|...||..|:||
pombe   821 EKRIYDQIFDAWDKERKGTLGGNAVLEIFGQSKLTRTELEHIWNLCDHGDKGSLDRDEFAVALHL 885

  Fly   331 VVLRRNNIPLPTSLPHCLHP--------------NVLQAAASG-------SGQGVTSSSSAALPQ 374
            :..:.|...:|..||..|.|              |:::...|.       :...:..:|....|.
pombe   886 IYRKLNGNEVPAVLPPELIPPSTRNFTESLNQVKNLIKNDTSNRKPFGAENQSKLKKNSFYDNPS 950

  Fly   375 EPPEAD--LLHLNDDDEDDHT-----------------------------------DNTIIAGNL 402
            |..|.|  |...||.|...:.                                   :.:::...|
pombe   951 ETTEKDATLYRHNDSDASAYVSSARRRDFKEEKIESAPPIINDIDSEIASLKKRIHEKSLVVNAL 1015

  Fly   403 SGSSTTSKPRPNVPSDKNIMNLSSI-------STSSQA--------------------------- 433
            ......:.|..:|.:|..|..:.|:       |||:::                           
pombe  1016 EDKKLAATPANDVQNDSLIYRIKSVQDEINRLSTSNKSPEVASMNVRLEELSTRVSKMLSDINEV 1080

  Fly   434 ----------------SNSSKREATPQNSLGKNRSISNS----------------------PNVE 460
                            :.:|..:.:|:.:..:||:||:.                      .|:|
pombe  1081 DHTIASLSLKLFQAEDTKNSYDQTSPEATQERNRTISSKLAEMEKQKNESKAALEQMKNYVTNIE 1145

  Fly   461 KPVSGTVSSTASAVD---STNVSSQWTKFSESPTTSAVSVQSTTGAAPVVAAGAAASGASSPGLK 522
            ..:...:..:|:..|   |.||..:             ||.......||.|..|..:      |.
pombe  1146 NNIRAKLLPSAANDDAWLSQNVVDE-------------SVTRVVKELPVPAPAAPQT------LN 1191

  Fly   523 PVLFDMKRSAQDVVSNPQILHPVPLRVTPIGTAIASSAESSNENESAVAQRE------------- 574
            |......:.::.:.||   .|...::.|....:.:|:.|.......|.|||.             
pombe  1192 PPSVSTVQQSKPIESN---THTPEVKATSESPSASSNLEDRAARIKAEAQRRMNERLAALGIKPR 1253

  Fly   575 ----DSPKAISSTT-------------VNNQSSAVVPGISGVAGSSHRDSSDLRAIQRPQAKKLP 622
                .||..::|.|             ...|:|||...:..|:.|.....:.:..:|.||    |
pombe  1254 QKGTPSPAPVNSATSTPVAAPTAQQIQPGKQASAVSSNVPAVSASISTPPAVVPTVQHPQ----P 1314

  Fly   623 AKNSALPPPPQREPSIGSTGPSESQEPQAAYVASSLASKK-EPP--------------------- 665
            .|.  :|....::||..||..:.:..||.|.:.:..:... |||                     
pombe  1315 TKQ--IPTAAVKDPSTTSTSFNTAPIPQQAPLENQFSKMSLEPPVRPAVPTSPKPQIPDSSNVHA 1377

  Fly   666 PLPPPRP------HR--HARSSSLDLNKFKIGATGGAQQAEITAQAS-----FDMQTSTGFADFT 717
            |.||.:|      |.  :||.|:.:........:.|:..:.|..:.|     ....|:.| |...
pombe  1378 PPPPVQPMNAMPSHNAVNARPSAPERRDSFGSVSSGSNVSSIEDETSTMPLKASQPTNPG-APSN 1441

  Fly   718 HFADEGAANVVDEQQLHSLPPA----------APPPQAAVVPPTRITL---------------QQ 757
            |     |..||....:|::.|.          ||.|.:|..||..::.               ..
pombe  1442 H-----APQVVPPAPMHAVAPVQPKAPGMVTNAPAPSSAPAPPAPVSQLPPAVPNVPVPSMIPSV 1501

  Fly   758 AQQRVSAFEVYRKPQTPRGSQSPPQQ--------PPPPAPAVGLTTQTGQLPSAESFEKRVTAIS 814
            |||..|:.    .|.|...|..||.|        |.||||         |.|||.:...  ....
pombe  1502 AQQPPSSV----APATAPSSTLPPSQSSFAHVPSPAPPAP---------QHPSAAALSS--APAD 1551

  Fly   815 DSLRHVS 821
            :|:.|.|
pombe  1552 NSMPHRS 1558

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RepsNP_609487.2 EH 262..345 CDD:197477 28/83 (34%)
EH 270..336 CDD:238009 23/66 (35%)
pan1NP_001342822.1 DUF1720 177..262 CDD:311924
EH 276..368 CDD:197477
DUF1720 422..508 CDD:311924
Med15 473..>796 CDD:312941 9/40 (23%)
EH 814..909 CDD:197477 31/95 (33%)
SMC_N <976..>1150 CDD:330553 17/174 (10%)
Atrophin-1 <1180..1637 CDD:331285 90/416 (22%)
WH2 1746..1772 CDD:308040
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001693
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11216
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5227
TreeFam 00.000 Not matched by this tool.
33.130

Return to query results.
Submit another query.