DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reps and ucp8

Sequence 1:NP_609487.2 Gene:Reps FlyBaseID:FBgn0032341 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_595633.2 Gene:ucp8 PomBaseID:SPBC83.01 Length:829 Species:Schizosaccharomyces pombe

Alignment Length:923 Identity:187/924 (20%)
Similarity:301/924 (33%) Gaps:283/924 (31%)


  Fly    63 ISRTQFYSCLKLIAAHQAAMPLRQELILATFPLPLPHFSWKEAVTAPVAVENGLTALPPPPPTDR 127
            :.|.|.|:|.:||:..|....| |||            .:.:|...|:        ||.....| 
pombe    63 LDRNQVYACFRLISQAQRGATL-QEL------------DYNKAGDPPI--------LPKQAKDD- 105

  Fly   128 RNSLRRNSQQEQLQDTSDV--------PSTDSEVEQNESVDDATGH-GRGTDGCG--------VV 175
             :.::|:|     .:|:|.        |...||.|: |..::..|| .....||.        ::
pombe   106 -HHIKRSS-----SETADFTPFRIPINPDERSEYEK-EFRENLRGHEDSARPGCMPSSIAKPILL 163

  Fly   176 SSSSRENVGRRRGGGTGGGSPEAWSTNSDS-------------------------------PTPT 209
            .||....|           ..:.|:. :||                               ..|.
pombe   164 KSSLHYAV-----------LAQIWNL-ADSAHVGYLEMYQYVIARHLVAICKQYNLIHLPRSLPA 216

  Fly   210 NSV----AERPWAQDTLWQG-----LLGDE---HRQLLGTEEESSDRHSSDDDDNESELVTIYQ- 261
            :.:    :|.|.....:.||     |:..|   |:|.:.:.:.|.....|.|::.:|.:...|. 
pombe   217 DVIESAKSETPAMNTNIEQGVTQPSLVNTEQLSHQQSISSTKSSKLDEISADNNAQSAVDNKYSS 281

  Fly   262 --------------ITPEQREYYNKQFRTVQRDPHGLLSGQAARNFFEKSRIPVEELRHIWQLCD 312
                          ||||.|..:.:.|..:..:..|.:.|..|..||..|.:..|||..||...|
pombe   282 PPQTIDPQANIKALITPEDRSNFYQLFSKIDNENKGYIVGGEAVPFFMASHLDSEELARIWDTVD 346

  Fly   313 VTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPH---CLHPNVLQAAASGSGQGVTSSSSAALPQ 374
            ....|.:...||..||.::.||.:...|.:.|.:   ...|.:.|...|..     :::|.|:| 
pombe   347 TQDRGYIDKDEFAVAMEIIKLRLSGKSLASILAYDDNPTEPTMQQNLVSDD-----TNASTAVP- 405

  Fly   375 EPPEADLLHLNDDDED------DHTDNTIIAGNLSGSSTTSKPRPNVPSDKNIMNLSSISTSSQA 433
                  :...||:..:      |:..|:.:  ||..||.|:...|           :::|.....
pombe   406 ------VAFTNDNVSNVPLSVADNEPNSTL--NLLASSDTAAFEP-----------TAVSLHENP 451

  Fly   434 SNSSK--REATPQNSLGKNRSISNSPNVEKPVSGTVSSTASAVDSTNVSSQWTKFSESPTTSAVS 496
            |:|.:  :.|....|.....|..|..|.......|.|.:         |:|...|...|||.:: 
pombe   452 SSSLEDLQSAFQNTSFQDQVSTQNQANTADISQNTESGS---------STQGQMFGIPPTTQSI- 506

  Fly   497 VQSTTGAAPVVAAGAAASGASSPGLKPVLFDMKRSAQDVVSNPQILHPVPLRVTPIGTAIASSAE 561
                    |:..||       .||      .:..|..|:.....:....|.:.......|.:|..
pombe   507 --------PLKMAG-------FPG------GVNSSLTDIKEEEAVSENAPQQEERSFEQIKTSIH 550

  Fly   562 SSNENESAVAQREDSPKAIS-STTVNNQSSAVVPGISGVAGSSHRDSSDLRAIQRPQAKKLPAKN 625
            .:.||.||:.:.:..|...| :||:...:||                    |:...|..:.|.:.
pombe   551 IAPENISAIEESKSVPLPTSFATTIPGSTSA--------------------ALDDQQTTEAPFEE 595

  Fly   626 SALPPPPQREPS-------------IGSTGPS-ESQEPQAAYVASSLASKK--------EPPPLP 668
               |..|..||:             |.||... |:.:.....:...:..||        |...|.
pombe   596 ---PDEPAHEPTEEEQEEMRKLEEKIESTKYGLETIQTSGKTIKQRIEQKKTRLMILREELQELD 657

  Fly   669 PPRPHRHAR-SSSLDLNK---FKIGATGGAQQAEITAQASFDMQTSTGFADFTHFADEGAANVVD 729
            ..:.....: |.||..::   .:||:.|..::..:........:..:..||.......||.|   
pombe   658 AIKEEAQKQISQSLIADQQLSTQIGSVGMGKKQAVKELRKLQAKIDSIIADSMSPMGTGAVN--- 719

  Fly   730 EQQLHSLPPAAPPPQAAVVPPTRITLQQAQQRVSAFEVYRKPQTPRGSQSPPQQPPPPAPAVGLT 794
                   .||. .||....|||                  ...||.....||  |||...::..:
pombe   720 -------SPAI-KPQVTPAPPT------------------PAPTPAVKHHPP--PPPVRSSISPS 756

  Fly   795 TQTGQLPSAESFEKRVTAISDSLRHVSFKQGQANTTEVLQRLREQNNSLLHLCNDLSDELLSVQT 859
            .....|..|.|        |..:.:||..:....:.|.:     ||:      |:|..||||:..
pombe   757 MPPAPLTHANS--------STPMNYVSQPESPPQSYESI-----QND------NELLQELLSMGF 802

  Fly   860 RKEEMRLKLEGLN 872
            .:|:..:.||..|
pombe   803 PREKAVIALEATN 815

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RepsNP_609487.2 EH 262..345 CDD:197477 27/83 (33%)
EH 270..336 CDD:238009 20/66 (30%)
ucp8NP_595633.2 EH 14..80 CDD:238009 7/17 (41%)
EH 124..223 CDD:197477 16/112 (14%)
EH 133..204 CDD:238009 12/84 (14%)
EH 304..370 CDD:238009 20/66 (30%)
EF-hand_7 305..362 CDD:290234 17/57 (30%)
UBA 790..826 CDD:197551 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11216
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.