DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reps and Eps15l1

Sequence 1:NP_609487.2 Gene:Reps FlyBaseID:FBgn0032341 Length:907 Species:Drosophila melanogaster
Sequence 2:XP_006509607.1 Gene:Eps15l1 MGIID:104582 Length:923 Species:Mus musculus

Alignment Length:1017 Identity:192/1018 (19%)
Similarity:303/1018 (30%) Gaps:361/1018 (35%)


  Fly     3 VSLTEPETRFYSELFQCCDVEKTGKVPMLKATELFRSADIANETVIEITGL------------AG 55
            :|||.|..:|:.........:.:.:.......|.....|...|:::.:.||            :.
Mouse    94 LSLTMPPPKFHDTSSPLMATQSSAETHWAVRVEEKAKFDGIFESLLPVNGLLSGDKVKPVLMNSK 158

  Fly    56 IPSTAL-------------HISRTQFYSCLKLIAAHQAAMPLRQELILATFPLPLPHFSWKEAVT 107
            :|...|             |:.|.:|     .:|.|.....|.:|        |:|         
Mouse   159 LPLDVLGRVWDLSDIDKDGHLDRDEF-----AVAMHLVYRALEKE--------PVP--------- 201

  Fly   108 APVAVENGLTALPPP--PPTDRRNSLRRNSQQEQLQDTSDVPSTDSEVEQNESVDDATGHGRGTD 170
                     :.||||  ||:.|:.::...:          ||...:.....:|:.....||    
Mouse   202 ---------SILPPPLIPPSKRKKTVFAGA----------VPVLPASPPPKDSLRSTPSHG---- 243

  Fly   171 GCGVVSSSSRENVGRRRGGGTGGGSPEAWSTNSDSPTPTNSVAERPWAQDTLWQGLLGDEHRQLL 235
                 |.||..:.|                    |.:|.:||.:.|.|    |...:.|:.|   
Mouse   244 -----SVSSLNSTG--------------------SLSPKHSVKQPPVA----WVVPVADKMR--- 276

  Fly   236 GTEEESSDRHSSDDDDNESELVTIYQITPEQREYYNKQFRTVQRDPHGLLSGQAARNFFEKSRIP 300
                                              :::.|.....|..|.:|||..:..|..|.:.
Mouse   277 ----------------------------------FDEIFLKTDLDLDGYVSGQEVKEIFMHSGLT 307

  Fly   301 VEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVL------------ 353
            ...|.|||.|.|..:.|.||..:|..||:.:   :..:......|..|.|:::            
Mouse   308 QNLLAHIWALADTRQTGKLSKEQFALAMYFI---QQKVSKGIDPPQVLSPDMVPPSERGTPIPDS 369

  Fly   354 -QAAASGSGQGVTS-----------------------SSSAALPQEPPEADLLHLNDDDEDDHTD 394
             ...|||...||..                       ....|:.|:..|...|. ||.|.:    
Mouse   370 SSTLASGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSEVQELQ-NDLDRE---- 429

  Fly   395 NTIIAGNLSGSSTTSKPR-----------PNVPSD------KNIMNLSSISTSSQASNSSKREAT 442
             |.....|......::.|           .::.||      .....:||:.|..|:..|..:...
Mouse   430 -TSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQTISSLKTQIQSQESDLKSQE 493

  Fly   443 PQNSLGK---NRSISNSPNVEKPVSG------TV--SSTASAVDSTNVSSQWTKFSESPTTSAVS 496
            ...:..|   ||.......:|:.:..      |:  |...:..|.....|:.::..||...:..|
Mouse   494 DDLNRAKSELNRLQQEETQLEQSIQAGRAQLETILRSLKCTQDDINQARSKLSQLQESHLEAHRS 558

  Fly   497 VQSTTGAAPVVAAGAAASGASSPGL------------------------KPVLFDMKRSAQDVVS 537
            ::........|      ||.|.|.|                        |.:||.         :
Mouse   559 LEQYDQVPDGV------SGTSLPDLATLNEGILLAERGGFGAMDDPFKNKALLFS---------N 608

  Fly   538 NPQILHPVPLRVTPIGTAIASSAESSNENESAVAQREDSPKAISSTTVNNQSSAVVPGISGVAGS 602
            |.|.|||.|.:        |.....|:..:.|...:.|..:  |......|::|..|    ..|.
Mouse   609 NSQELHPDPFQ--------AEDPFKSDPFKGADPFKGDPFQ--SDPFSEQQTAATDP----FGGD 659

  Fly   603 SHRDSSDLRAIQRPQAKKLPAKNSALPPPP-QREPSIGS-TGPSESQEPQAAYVASSLASKKEPP 665
            ..::|....:.......|...||......| .:.||:.| ..|.||.:|   :.:||::||...|
Mouse   660 PFKESDPFHSSSSDDFFKKQTKNDPFTSDPFTKNPSLPSKLDPFESSDP---FSSSSISSKGSDP 721

  Fly   666 PLPPPRPHRHARSSSLDLNKFKIGATGGAQQAEITAQASFDMQTSTGFADF-------------- 716
                        ..:||                  ...|....::.|||||              
Mouse   722 ------------FGTLD------------------PFGSSSFSSAEGFADFSQMSKPPPSGPFSS 756

  Fly   717 ----THFADEGAANVVDEQQLHSLPPAAP-PPQAAVVPPTRITLQQAQQRVSAFEVY------RK 770
                |.|:|:...:   :|...:|||..| ||:..  ||:     :|........||      ..
Mouse   757 SLGGTGFSDDPFKS---KQDTPALPPKKPAPPRPK--PPS-----EAAAGEKGTVVYTLLGGQST 811

  Fly   771 PQTPRGSQSPPQQPPPPAPAVGLTTQ-------------TGQLPSAESFEKR--VTAISDSLRHV 820
            |.:..||...|:.|.|..| :|..:.             :|:.|.|.|...:  .|:.|......
Mouse   812 PVSQLGSSDFPESPDPFQP-LGADSGDPFQNKKGFGDPFSGKDPFAPSSSAKPPKTSSSGFADFT 875

  Fly   821 SF-----------KQGQANTTEVLQRLREQNNSLLHLCNDLS 851
            ||           ::.:....|.|.|||.|....|.|...||
Mouse   876 SFGNEEQQLAWAKRESEKAEQERLARLRRQEQEDLELAIALS 917

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RepsNP_609487.2 EH 262..345 CDD:197477 20/83 (24%)
EH 270..336 CDD:238009 20/66 (30%)
Eps15l1XP_006509607.1 EH 13..103 CDD:197477 4/9 (44%)
EH 19..85 CDD:238009
EH 121..200 CDD:197477 15/92 (16%)
EH 131..196 CDD:238009 12/70 (17%)
EH 266..362 CDD:197477 27/140 (19%)
EH 277..343 CDD:238009 20/69 (29%)
SPEC 383..564 CDD:295325 28/187 (15%)
TPR_MLP1_2 396..523 CDD:285204 21/133 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.