DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reps and eps15l1

Sequence 1:NP_609487.2 Gene:Reps FlyBaseID:FBgn0032341 Length:907 Species:Drosophila melanogaster
Sequence 2:XP_012812304.1 Gene:eps15l1 XenbaseID:XB-GENE-959469 Length:919 Species:Xenopus tropicalis

Alignment Length:1016 Identity:189/1017 (19%)
Similarity:328/1017 (32%) Gaps:295/1017 (29%)


  Fly    12 FYSELFQCCDVEKTGKVPMLKATELFRSADIANETVIEITGLAGIPSTALHISRTQFYSCLKLIA 76
            ||...::..|....|:|...:|....:.:.:::..:.:|..||. |....::.:..||..|:|:|
 Frog    16 FYETYYKQVDPSYIGRVGPAEAALFLKKSALSDIILGKIWDLAD-PEGKGYLDKHGFYVALRLVA 79

  Fly    77 AHQAAMPLRQELILATFPLPLPHFSWKEAVTAPVAVENGLTALPPPPPTDRRNSLRRNSQQ---- 137
            ..|:.    .|:.|::..:|:|         ||...:.....|..|||.:....:|...:.    
 Frog    80 CAQSG----HEVSLSSLNVPVP---------APKFHDTSSPLLITPPPVEGHWGVRIEEKSKFDG 131

  Fly   138 --EQLQDTSDVPSTD--SEVEQNESVD-------------DATGH-GRGTDGCG---VVSSSSRE 181
              :.|...:.:.|.|  ..|..|..:.             |..|| .|......   |..:..:|
 Frog   132 IFDSLVPVNGLLSGDKVKPVLMNSKLPLDVLGRVWELSDIDKDGHLDRDEFAVAMHLVYRALEKE 196

  Fly   182 NV-----------GRRRGGGTGGGSPEAWSTNSDSPTPTNSVAERPWAQDTLWQGLLGDEHRQL- 234
            .|           .:|:...|   .|.|.|....||.|.:|:...|             .|..: 
 Frog   197 PVPSVLPPSLIPPNKRKKTPT---FPGAVSVLPSSPPPKDSLRSTP-------------SHGSMS 245

  Fly   235 -LGTEEESSDRHSSDDDDNESELVTIYQITPEQREYYNKQFRTVQRDPHGLLSGQAARNFFEKSR 298
             |.:....|.:|||  ...:..:..:..:|.:.|  ::..|.....|..|.:||...::.|.:|.
 Frog   246 SLNSAGSLSPKHSS--KPAQPAVNWVVPLTDKMR--FDDIFLQTDLDMDGFVSGLEVKDIFMQSG 306

  Fly   299 IPVEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAAASGSGQG 363
            :....|.|||.|.|..:.|.|:..:|..||:.:.|:   :......|..|.|:::..:...:...
 Frog   307 LSQNILAHIWALADTRQTGKLNKDQFALAMYFIQLK---VSKGIDPPQVLSPDMIPPSERNTPIQ 368

  Fly   364 VTSSSSAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSG---SSTTSKPRPNVPSDKNIMNLS 425
            ..|.....:..|     :..|.|...|  :.:::.:|..:|   ....|:....:..:|..:. .
 Frog   369 TLSGYMTPIGNE-----MASLTDMRRD--SSSSVGSGEFTGVKELDEISQEIAQLQREKYALE-Q 425

  Fly   426 SISTSSQASNSSKREATP-QNSLGKNRSISNSPNVEKP-----VSGTVSSTASAVDSTNVSSQWT 484
            .|....:|......|... ||.|.:..|.......:|.     :.......|...|..|...|..
 Frog   426 DIREKEEAIRQKSTEVQDLQNDLDRETSTLQELEAQKQDAQDRLDEMDQQKAKLKDMLNDVRQKC 490

  Fly   485 KFSESPTTSAVSVQSTTGAAPVVAAGAAASGASSPGLKPVLFDMKRSAQDVVSNPQILHPVPLRV 549
            : .|....|::.:|..:..:.|.|.....:.|.|        ::.|..|:.....|.:....:::
 Frog   491 Q-EEGQMISSLKIQIQSQESDVKAQEEELNRAKS--------ELNRLQQEETQLEQSIQAGRVQL 546

  Fly   550 TPIGTAIASSAESSNENESAVAQREDSPKAISSTTVNNQSSAVVPGISGVAGSSHRDSSDLRA-- 612
            ..|..::.|:.|..|:..|.::|.::|.:.:     |..|......::|..|||..:.||..:  
 Frog   547 ETIIKSLKSTQEEINQARSKLSQLQESQQEL-----NQNSDQYNDALNGDHGSSMNNLSDTESFS 606

  Fly   613 ----------IQRPQAKK----------------------------------------------- 620
                      |:.|...|                                               
 Frog   607 SRERTDHSSTIEDPFKNKSHLFSNNNQDIYSDPFQTEDPFTSDPFKGADPFKSNPFGDDPFKESD 671

  Fly   621 ------------LPAKNSALPPPPQREPSIGS------TGPSESQEPQAAYVASSLASKKEPPPL 667
                        .|||.......|..:.|:.|      :.|.||.:|   :::|:|..||..|  
 Frog   672 PFHAPTSEDPFQKPAKGDPFSADPFTKNSVHSMTLPLKSDPFESSDP---FISSTLPKKKTDP-- 731

  Fly   668 PPPRPHRHARSSSLDLNKFKIGATGGAQQAEITAQASFDMQTSTGFADFTHFADEGAANVVDEQQ 732
                      ..:||    ..|::.              ..::..||||:|.:.:          
 Frog   732 ----------FGTLD----PFGSSA--------------FSSNESFADFSHMSKQ---------- 758

  Fly   733 LHSLPPAAPPPQAAVVPPTRITLQQAQQRVSAFEVYRKPQTPRGSQSPPQQ--PPPPAPAVGLTT 795
             |.    ||.|.:|..|.|..:....:.         |..||   ..||::  ||.|.|..|.:|
 Frog   759 -HQ----APDPFSATFPGTGFSDDPFKS---------KHDTP---ALPPKRSVPPRPKPPSGKST 806

  Fly   796 QTGQLPSA-----------------ESFEKRVT-----------AISDSLRHV-----------S 821
            ...||.::                 :.|:.|.:           |.|.|.:|.           |
 Frog   807 PVSQLSTSHFQKSHDPFQPFGTEPGDPFQSRKSFTDPFSGKDPFATSQSGKHSKGTSAGFANFGS 871

  Fly   822 F-----------KQGQANTTEVLQRLREQNNSLLHLCNDLS 851
            |           ::.|....|.|.||:.|....|.|...||
 Frog   872 FGNEEQQLAWAKRESQRAEKERLDRLKRQEQEDLELAIALS 912

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RepsNP_609487.2 EH 262..345 CDD:197477 21/83 (25%)
EH 270..336 CDD:238009 19/66 (29%)
eps15l1XP_012812304.1 EH 6..101 CDD:197477 22/99 (22%)
EH 17..83 CDD:238009 15/67 (22%)
EH 119..212 CDD:197477 13/93 (14%)
EH 129..194 CDD:238009 10/65 (15%)
EH 267..363 CDD:197477 24/101 (24%)
EH 278..344 CDD:238009 19/69 (28%)
SPEC 405..587 CDD:295325 33/197 (17%)
TPR_MLP1_2 455..581 CDD:285204 23/140 (16%)
NPF <552..694 CDD:293209 20/147 (14%)
BMP2K_C 689..887 CDD:291930 48/258 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.