DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-3 and SET5

Sequence 1:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_012077.1 Gene:SET5 SGDID:S000001250 Length:526 Species:Saccharomyces cerevisiae

Alignment Length:425 Identity:81/426 (19%)
Similarity:138/426 (32%) Gaps:151/426 (35%)


  Fly    21 GRYLVAKGAIRGHGLLIEELPFAVGPKCNGPVVCLGCYEPNPDPEEEL--------CSECGWPLC 77
            ||.|.||.......::::|         |.|:|    |.|   |.::|        |:.||..| 
Yeast   124 GRGLFAKRDFSKGQIILKE---------NKPIV----YIP---PLDKLFLISNGKACARCGKAL- 171

  Fly    78 VECAQQADNAHFRLEC---------SQLKDARARFFRLPSGSRHCPQLDCIMPLRVLLAKEANPE 133
            .:..|.....|: |:|         .:.|.|.|....|...|....::|.:           :..
Yeast   172 YDLTQHKIMVHY-LDCEVCKAIWCSEKCKKAHASLHELLYHSWRSNRIDIL-----------HAG 224

  Fly   134 RWDNEVAPMEHH-----------------------KEERQRDADVWHADRVNIA---------QY 166
            .|...|...|.:                       ||:.|:.|.:...:|:.:.         ..
Yeast   225 NWKRFVNYCEKYCFTAAFSVGLIYGSMLLDTTGEVKEQWQKLASISQRERIKLRDASGIGSTFSL 289

  Fly   167 LRGP---------------------------------CQLANRFSEEL----IMQVVGVLEVNAF 194
            |.|.                                 |....:.|||:    .:.::|...:|.:
Yeast   290 LNGTTVHTEEESDNGTKKGVEKNIDDETVWEKCYELFCGAFPKASEEIDFEKFLTMIGTFNINQY 354

  Fly   195 EARSPKGYPLRCLFPYTGILAHNCVPNTSRSIY---PSEGYKIRLRAMVDLEEGQPLHHSYTYTL 256
            ..:         ::.:...:.|:|.||.    |   ..|..::||.|...:::|:.:..:|...|
Yeast   355 NGQ---------VYHWISFINHDCEPNA----YIEQVEEHEELRLHARKPIKKGEQIRITYVNPL 406

  Fly   257 DGTAQRQKHLKQGKFFTCQCERCLDPTELGTHFSSLKCGQCAEGFQVPR-QPTEPDTSWNCANCG 320
            .|...|::.|:....|.|||:||  ..||.| |.           :||. :....|.:.......
Yeast   407 HGVRLRRRELRVNWGFLCQCDRC--QNELST-FE-----------RVPNLEKKNADANLGVEKID 457

  Fly   321 SDTSNADALAMLQSLQSEVNAVQALPMAAKRLEEI 355
            |:.|:.|.     |.:|..|...::..|...|:||
Yeast   458 SNDSSEDG-----SKKSTGNRKSSMREAQPDLKEI 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 10/48 (21%)
SET5NP_012077.1 SET 41..526 CDD:225491 81/426 (19%)
SET <342..402 CDD:279228 12/73 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.