DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-3 and SET6

Sequence 1:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_015160.1 Gene:SET6 SGDID:S000006086 Length:373 Species:Saccharomyces cerevisiae

Alignment Length:121 Identity:33/122 (27%)
Similarity:52/122 (43%) Gaps:10/122 (8%)


  Fly   166 YLRGPCQLANRFSEELIMQVVGVLEVNAF------EARSPKGYPLRCLFPYTGILAHNCVPNTSR 224
            |:..|..|....|..|:..::|....|||      ||...:.|....:||......|:|.||.::
Yeast   248 YILLPSHLHRMLSIPLLRHILGTEYGNAFGLWQEGEASDSREYFGYWVFPEASYFNHSCNPNITK 312

  Fly   225 SIYPSEGYKIRLRAMVDLEEGQPLHHSYTYTLD-GTAQRQKHLKQGKFFTCQCERC 279
            .   .:|..:......|:::.:.:...|:..|| .|.:|:..|....||.|.||||
Yeast   313 Y---RKGNSMLFTMNRDIKKDEQICIDYSGVLDLPTVKRRAFLADSWFFDCACERC 365

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 8/45 (18%)
SET6NP_015160.1 SET <1..370 CDD:225491 33/122 (27%)
SET <295..338 CDD:214614 9/46 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.