DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-3 and ASHR2

Sequence 1:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_849991.1 Gene:ASHR2 AraportID:AT2G19640 Length:398 Species:Arabidopsis thaliana

Alignment Length:308 Identity:69/309 (22%)
Similarity:109/309 (35%) Gaps:82/309 (27%)


  Fly    21 GRYLVAKGAIRGHGLLIEELPF-----------AVGPKCNGPVVCLGCYEPNPDPEEELCSECGW 74
            ||.|||..::|...:::.|.|.           :|.|.|:      .|:........:.|..|. 
plant    22 GRSLVAAQSLRAGQVILRESPLLLYSAFPFLSSSVSPYCD------HCFRLLASSAHQKCQSCS- 79

  Fly    75 PLCVECAQQADNAHFRLECSQL-----------------KDARARF----FRLPSGSRHCPQLDC 118
             |...|:.....:|....|..|                 :..:|||    :.|.:.|....|:  
plant    80 -LVSFCSPNCFASHTPWLCESLRRLHQSSSSAFSDQPSDRQVQARFLLSAYNLAAASPSDFQI-- 141

  Fly   119 IMPLRVLLAKEANP--ERWDNEVAPMEHH-----------KEERQRDADVWHADRVNIAQYLRGP 170
            ::.|:...:...:|  ...|:..|...|.           .......|.:...|:|| |..|..|
plant   142 LLSLQGSGSSNGDPSCSAGDSAAAGFLHSLLSSVCPSLPVSISPDLTAALLSKDKVN-AFGLMEP 205

  Fly   171 CQLANRFSEELIMQVVGVLEVNAFEARSPKGYPLRCLFPYTGILAHNCVPNTSRSIY---PSEG- 231
            |.::|                   |.||.:.|.   ::|.|....|:|:||..|..|   .|:| 
plant   206 CSVSN-------------------EKRSVRAYG---IYPKTSFFNHDCLPNACRFDYVDSASDGN 248

  Fly   232 YKIRLRAMVDLEEGQPLHHSYTYTLDGTAQRQKHLKQGKFFTCQCERC 279
            ..|.:|.:.|:.||:.:..||.......:.|||.|.:...|.|.|:||
plant   249 TDIIIRMIHDVPEGREVCLSYFPVNMNYSSRQKRLLEDYGFKCDCDRC 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 16/49 (33%)
ASHR2NP_849991.1 SET <192..275 CDD:214614 29/106 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.