DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-3 and SDG37

Sequence 1:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_849969.2 Gene:SDG37 AraportID:AT2G17900 Length:485 Species:Arabidopsis thaliana

Alignment Length:488 Identity:112/489 (23%)
Similarity:183/489 (37%) Gaps:97/489 (20%)


  Fly    18 PVCGRYLVAKGAIRGHGLLIEELPFAVGP-KCNGPVVCLGCYEPNPDPEEELCSECG--WPLCVE 79
            |..||.|......|...:::.:.|:...| ..:....|.||::.|   ..:.||.|.  | .|..
plant    24 PQKGRSLFTARDFRPGEVILSQKPYICVPNNTSSESRCDGCFKTN---NLKKCSACQVVW-YCGS 84

  Fly    80 CAQQADNAHFRLECSQLK--DARARFFRLPSGSRHCPQLDCIMPLRVLLAKEANPERWDNEVAPM 142
            ..|:::....|.||..|.  :...|.|..|:             :|:::.........:.:|.|:
plant    85 SCQKSEWKLHRDECKALTRLEKEKRKFVTPT-------------IRLMVRLYIKRNLQNEKVLPI 136

  Fly   143 EHHKEERQRDADVWHADRVNIAQYLRGPCQLANRFSEELIMQVVGV-----------LEVNAF-- 194
            .........:|.|.|...::..|.|. ..|:||..:  ||:|...|           ...||.  
plant   137 TTTDNYSLVEALVSHMSEIDEKQMLL-YAQMANLVN--LILQFPSVDLREIAENFSKFSCNAHSI 198

  Fly   195 ---EARSPKGYPLRCLFPYTGILAHNCVPNTSRSIYPSEGYKIRLRAMVDLEEGQPLHHSYTYTL 256
               |.| |:|..   |||...|:.|:|.||   ::...|.....:|||.::.:...:..||..|.
plant   199 CDSELR-PQGIG---LFPLVSIINHSCSPN---AVLVFEEQMAVVRAMDNISKDSEITISYIETA 256

  Fly   257 DGTAQRQKHLKQGKFFTCQCERCLD---PTEL-------GTHFSSLKCGQCAEGFQVPRQPTEPD 311
            ..|..|||.||:...|.|||.||.:   |.::       |...::.||    .||.: |.|.|  
plant   257 GSTLTRQKSLKEQYLFHCQCARCSNFGKPHDIEESAILEGYRCANEKC----TGFLL-RDPEE-- 314

  Fly   312 TSWNCANCGSDTSNADALAMLQSLQSEVNAVQALPMAAKRLEEIERLLRKYKS-------LLHPL 369
            ..:.|..|....|..:    ::.|.|::..|......:...|:.:..:..||:       |.|..
plant   315 KGFVCQKCLLLRSKEE----VKKLASDLKTVSEKAPTSPSAEDKQAAIELYKTIEKLQVKLYHSF 375

  Fly   370 HFIATGLRQLLIEMYGRVQGYEMVQLPDHQLERKA-ELCRQVLRVLNTFEPGLSRTRAMNLYELH 433
            .......|:.|::|           |.|.::.|:| ..||.::.|.....|.......:..|   
plant   376 SIPLMRTREKLLKM-----------LMDVEIWREALNYCRLIVPVYQRVYPATHPLIGLQFY--- 426

  Fly   434 VPLVLLAKSGFIAGKLKGGELRARLVDAIDLLK 466
                ...|..::.|:.|  |..:.|:.|.|:|:
plant   427 ----TQGKLEWLLGETK--EAVSSLIKAFDILR 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 13/45 (29%)
SDG37NP_849969.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.