DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-3 and Smyd4-3

Sequence 1:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_725048.1 Gene:Smyd4-3 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster

Alignment Length:419 Identity:92/420 (22%)
Similarity:154/420 (37%) Gaps:108/420 (26%)


  Fly    21 GRYLVAKGAIR-GHGLLIEELPFA-------VGPKCNG-------PVVCLGCYEPNPDPEEELCS 70
            ||:..|...:: |..||:|. ||.       ....|..       ||.|..|      .:...||
  Fly   250 GRFARASADVKPGEELLVER-PFVSVLLEKFAKTHCENCFMRTVVPVACPRC------ADVLYCS 307

  Fly    71 ECGWPLCVECAQQADNAHFRLECSQLKDARARFFRLP----SG---SRH-------CPQLDCIMP 121
            |       :|.::|...:.:.||.          .:|    ||   :.|       ...||..:.
  Fly   308 E-------QCREEASKKYHKYECG----------IVPIIWRSGASINNHIALRIIASKPLDYFLK 355

  Fly   122 LRVLLAKEANPERWDN-------EVAPMEHHKEERQRDADVWHADRVNIAQYLRGPCQLANRFSE 179
            |:..:.:|..||:..:       .||.:|.|:.|||......|   |.:|::|....:....|..
  Fly   356 LKPTIDEELTPEQLISLPKDDFRRVAQLERHQGERQPSNFFQH---VLMARFLTNCLRAGGYFGS 417

  Fly   180 E-----------LIMQVVGVLEVNAFE----------ARSPKGYPLRCLFPYTGILAHNCVPNTS 223
            |           |:::.:..::.|..|          .|....:....::|...:..|:|.|...
  Fly   418 EPKPDEVSIICSLVLRSLQFIQFNTHEVAELHKFSSSGREKSIFIGGAIYPTLALFNHSCDPGVV 482

  Fly   224 RSIYPSEGYKIRLRAMVDLEEGQPLHHSY--TYTLDGTAQRQKHLKQGKFFTCQCERCLDP---- 282
            |..   .|..|.:.::..:|.|.|::.:|  .||.|..::||..||...:|.|.|:.|:|.    
  Fly   483 RYF---RGTTIHINSVRPIEAGLPINENYGPMYTQDERSERQARLKDLYWFECSCDACIDNWPKF 544

  Fly   283 TELGTHFSSLKC---GQCAEGFQVPRQPTEPDTSWNCANCGSDTSNADALAMLQSLQSEVNAVQA 344
            .:|.......:|   ..|:...:||  |:..|....|..||..|:....|.::|.       .:.
  Fly   545 DDLPRDVIRFRCDAPNNCSAVIEVP--PSCNDFMVKCVTCGEITNILKGLKVMQD-------TEM 600

  Fly   345 LPMAAKRL---EEIERLLRKYKSLLHPLH 370
            :...||||   .|..:.|.|:..|:..::
  Fly   601 MTRTAKRLYETGEYPKALAKFVDLIRIMY 629

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 10/45 (22%)
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150
TPR repeat 74..103 CDD:276809
TPR repeat 108..142 CDD:276809
TPR repeat 150..177 CDD:276809
zf-MYND 284..323 CDD:280009 11/52 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.