DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-3 and Smyd4-1

Sequence 1:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster

Alignment Length:517 Identity:96/518 (19%)
Similarity:164/518 (32%) Gaps:182/518 (35%)


  Fly    21 GRYLVAKGAIRGHGLLIEELPFAVGP--------KC-----NGPVVCLGCYEPNPDPEEELCSEC 72
            |||:|||.||....::..|......|        :|     :.|:.|..|::             
  Fly   226 GRYMVAKEAISKGNVIFSERASCFVPLEQLLICQQCAATLMSAPIPCPNCHQ------------- 277

  Fly    73 GWPLCVECAQQADNAH---FRLECSQLKDARARFFRLPSGSRHCPQLDCIMPLRVLLA------- 127
               ..|.|:::...||   .:.||:..:....|..    |..|       :.||:||.       
  Fly   278 ---RVVYCSRKCREAHSAIHKFECAAYRKDILRLL----GISH-------LALRLLLTYIPYIRP 328

  Fly   128 --KEANPER--WDNEVAPMEHHKEERQR------------------DADV-WHADRVNIAQ-YLR 168
              :|....:  |: |:..:....||.:.                  |.:: :|....|:.| ||:
  Fly   329 HLQEMTSAKGMWE-EIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLK 392

  Fly   169 GPCQLANRFS-------------EELIMQVVGVLEVNAF-------EARSPKGY----------- 202
            ......::|.             ..||::..|.|..|..       ....||.:           
  Fly   393 EHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKP 457

  Fly   203 ---------------PLRCL-FPYTGILAHNCVPNTSRSIYPSEGYKIRLRAMVDLEEGQPLHHS 251
                           |:..: .||..:..|.|.|:.....   :|..:...|..|:.||:.:.:.
  Fly   458 RHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKF---DGCSVVNYAAKDILEGEEIFNC 519

  Fly   252 YT--YTLDGTAQRQKHLKQGKFFTCQCERC--LDPTELGTHFSSLKCGQ--CAEGFQVPRQPTEP 310
            ||  |......||...||....|.|.|.:|  .||.:....|...:|.:  |.:.|....:..:.
  Fly   520 YTMDYRNSLKLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQN 584

  Fly   311 DTSW----------NCANC-------------GSDTSNADALAMLQSLQSEVNAVQALPMAAKRL 352
            :..|          .|..|             |...|:||:           :..|||   .|..
  Fly   585 NLRWWLRCNAEKPITCTVCHELQHFAWYNEFLGLIGSSADS-----------SKRQAL---FKAF 635

  Fly   353 EEIERLLRKYKSLLHPLHFIATGLRQLLIEMYGRVQGYEM---VQLPDHQLERKAELCRQVL 411
            :::::.|..:.|           |::::.|.......||:   ..|.:.:.|..|.:.|:.|
  Fly   636 DDLDKWLVDHHS-----------LKRIMAEELVTACFYEIDGGTSLDEFEYEDLARIIRKQL 686

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 10/46 (22%)
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 9/56 (16%)
SET <447..526 CDD:214614 14/82 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.