DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-3 and Smyd2

Sequence 1:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_996733.1 Gene:Smyd2 RGDID:727785 Length:433 Species:Rattus norvegicus

Alignment Length:292 Identity:70/293 (24%)
Similarity:111/293 (38%) Gaps:67/293 (23%)


  Fly    26 AKGAI-------RGHGLLIEELPFAVGP---KCNGPVV------------CLGCYEPNPDPEEEL 68
            |:|.:       :|.||.... ||.||.   .|  |..            |..|:     ..:|.
  Rat     5 ARGGLERFCSAGKGRGLRALR-PFHVGDLLFSC--PAYACVLTVGERGHHCECCF-----ARKEG 61

  Fly    69 CSECGWPLC-------VECAQQADNAHFRLECSQLKDARARFFRLPSGSRHCPQLDCIMPLRVLL 126
            .|:||  .|       ||| |:.|....:||||.:         :..|....|.....:..|:|.
  Rat    62 LSKCG--RCKQAFYCDVEC-QKEDWPLHKLECSSM---------VVFGENWNPSETVRLTARILA 114

  Fly   127 AKEANPERWDNE----VAPMEHHKEERQRD-ADVWHADRVNIAQYLRGPCQLANRFSEELIMQVV 186
            .::.:|||..:|    |...|.|.::...: .|:..:|...:.|:.....:..:..|   ::.:.
  Rat   115 KQKMHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKHLEFPDHSS---LVVLF 176

  Fly   187 GVLEVNAF----EARSPKGYPLRCLFPYTGILAHNCVPNTSRSIYPSEGYKIRLRAMVDLEEGQP 247
            ..:..|.|    |..|..|   ..:||...::.|:|.||.   |...:|....:||:.::..|..
  Rat   177 AQVNCNGFTIEDEELSHLG---SAIFPDVALMNHSCCPNV---IVTYKGTLAEVRAVQEIHPGDE 235

  Fly   248 LHHSYTYTLDGTAQRQKHLKQGKFFTCQCERC 279
            :..||...|..|..|...|:...||||:|..|
  Rat   236 VFTSYIDLLYPTEDRNDRLRDSYFFTCECREC 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 12/45 (27%)
Smyd2NP_996733.1 S-adenosyl-L-methionine binding. {ECO:0000250} 17..19 1/2 (50%)
zf-MYND 52..90 CDD:280009 14/46 (30%)
Peptide substrate binding. {ECO:0000250} 183..185 1/2 (50%)
SET <204..240 CDD:279228 10/39 (26%)
S-adenosyl-L-methionine binding. {ECO:0000250} 206..207 0/1 (0%)
S-adenosyl-L-methionine binding. {ECO:0000250} 258..260 1/2 (50%)
TPR_12 338..413 CDD:290160
TPR_10 381..422 CDD:290111
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.