DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-3 and Smyd2

Sequence 1:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_081072.1 Gene:Smyd2 MGIID:1915889 Length:433 Species:Mus musculus

Alignment Length:451 Identity:96/452 (21%)
Similarity:153/452 (34%) Gaps:155/452 (34%)


  Fly    26 AKGAI-------RGHGLLIEELPFAVGP---KCNGPVV------------CLGCYEPNPDPEEEL 68
            |:|.:       :|.||.... ||.||.   .|  |..            |..|:     ..:|.
Mouse     5 ARGGLERFCSAGKGRGLRALR-PFHVGDLLFSC--PAYACVLTVGERGHHCECCF-----ARKEG 61

  Fly    69 CSECGWPLC-------VECAQQADNAHFRLECSQLKDARARFFRLPSGSRHCPQLDCIMPLRVLL 126
            .|:||  .|       ||| |:.|....:||||.:         :..|....|.....:..|:|.
Mouse    62 LSKCG--RCKQAFYCDVEC-QKEDWPLHKLECSSM---------VVLGENWNPSETVRLTARILA 114

  Fly   127 AKEANPERWDNE----VAPMEHHKEERQRD-ADVWHADRVNIAQ----YLRGPCQLANRFSEELI 182
            .::.:|||..:|    |...|.|.::...: .|:..:|...:.|    ||..|       ....:
Mouse   115 KQKIHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFP-------DHSSL 172

  Fly   183 MQVVGVLEVNAF----EARSPKGYPLRCLFPYTGILAHNCVPNTSRSIYPSEGYKIRLRAMVDLE 243
            :.:...:..|.|    |..|..|   ..:||...::.|:|.||.   |...:|....:||:.::.
Mouse   173 VVLFAQVNCNGFTIEDEELSHLG---SAIFPDVALMNHSCCPNV---IVTYKGTLAEVRAVQEIH 231

  Fly   244 EGQPLHHSYTYTLDGTAQRQKHLKQGKFFTCQCERCLDPTELGTHFSSLKCGQCAEGFQVPRQPT 308
            .|..:..||...|..|..|...|:...||||:|..|                             
Mouse   232 PGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECREC----------------------------- 267

  Fly   309 EPDTSWNCANCGSDTSNADALAMLQSLQSEVNAVQALPMAAKRLEEIERLLRKYKSLLHPLHFIA 373
                         .|.:.|      ..:.||..:.:.|.|    |.|..::|..::         
Mouse   268 -------------TTKDKD------KAKVEVRKLSSPPQA----EAIRDMVRYARN--------- 300

  Fly   374 TGLRQLLIEMYGRVQGYEMVQLPDHQLERKAELCRQVLRVLNTFEPGLSRTRAMNLYELHV 434
                  :||.:.|.:.|:.   |...|| ..||.::  ::.:.||..       |:|.||:
Mouse   301 ------VIEEFRRAKHYKS---PSELLE-ICELSQE--KMSSVFEDS-------NVYMLHM 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 12/45 (27%)
Smyd2NP_081072.1 S-adenosyl-L-methionine binding. {ECO:0000250} 17..19 1/2 (50%)
zf-MYND 52..90 CDD:307734 14/46 (30%)
SET <157..240 CDD:307139 21/96 (22%)
Peptide substrate binding. {ECO:0000250} 183..185 1/2 (50%)
S-adenosyl-L-methionine binding. {ECO:0000250} 206..207 0/1 (0%)
S-adenosyl-L-methionine binding. {ECO:0000250} 258..260 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.