DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-3 and set-30

Sequence 1:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_508850.2 Gene:set-30 WormBaseID:WBGene00022499 Length:560 Species:Caenorhabditis elegans

Alignment Length:561 Identity:113/562 (20%)
Similarity:184/562 (33%) Gaps:180/562 (32%)


  Fly    38 EELPFAVG-PKCNGPVVCLGCYEPNPDPEEELCSECGWPLCVECAQQADNA---HFRLECSQLKD 98
            |..|||.. ..|.....|..|...|   .|..|.:|  .:...|::|.:.:   ..:.||..|| 
 Worm    24 EFYPFAYSLLDCTKDDYCWTCLGEN---VELTCEQC--KVAKFCSKQCETSGAIDHKYECGPLK- 82

  Fly    99 ARARFFRLPSGSRHCPQL--DCIMPLRVLLAKEANPERWDNEVAPMEHHKEERQRDADVWH--AD 159
                         .||.|  |..|.:|::...:......|..:....:::|.::...::|.  ||
 Worm    83 -------------KCPDLNTDERMLIRIVGRYKDIHSGKDKSIDGFYNNRESKRSVMEIWEHCAD 134

  Fly   160 R---VNIAQYLRGPCQLANRF-------SEELIMQVVGVLEVNAFEARS-------PKG-YPLRC 206
            .   .|..:..:.......:|       .||:..|:.....:|.....:       .|| |...|
 Worm   135 MKKDENAMKSFKKTYDRVKQFGDTNHLMDEEVTFQLHSRNFINRHSISNVDYLREIGKGLYLDLC 199

  Fly   207 LFPYTGILAHNCVPNTSRSIYPSEGYKIRLRAM---VDLEEGQPLHHSYTYTLDGTAQRQKHLKQ 268
            .:.      |:|.||   :||...|...:|||:   ||||..:..|::|........||:..||:
 Worm   200 KYD------HSCRPN---AIYSCNGIVAKLRALHDNVDLENVETTHYTYIELPPCKIQRRHMLKE 255

  Fly   269 GKFFTCQCERCLDPTELGTHFSSLKCGQCAEGFQV--------PRQPTEPDT-SWNCANC----- 319
            ..:|.|.||||.||.:  ...:|:.|..|....:.        |.....|:| ...|..|     
 Worm   256 TWYFECHCERCDDPDD--NWLTSVLCPVCISKTEYRKTIKLHGPEAYANPETLEIVCDRCSTTLD 318

  Fly   320 -------------------GSDTSNADALAMLQSLQSEVNAVQ-ALPMA--------AKRLEEIE 356
                               |::....|.:.:|:..|..:...: .|||:        |..:..|.
 Worm   319 REYIFMALDGMRTIRRTVEGAEDETKDPIELLKIYQGALMTYERILPMSNAYFCQLIAAMIPLIS 383

  Fly   357 RLLRKYKSLL---------------------HP---LHFIATGLRQLLIEMYGRVQGYEMVQLPD 397
            |:....|..|                     ||   :||:..|  ||.:|:..            
 Worm   384 RVSMTKKERLVASLDLHLKCETFVRYVYRHAHPSKAMHFLQMG--QLHLELAN------------ 434

  Fly   398 HQLERKAELCRQVLRVLNTFEPGLSRTRAMNLYELH-VPLVLLAKSGFIAGKLKG---------G 452
               ::.|..|                     |.|.| :...|.....|::.:.||         .
 Worm   435 ---DKDAARC---------------------LIEAHRIMDYLFGADHFLSKQTKGFMDHALSSLM 475

  Fly   453 ELRARLVDAIDLLKECVEILEFEDKSSQEGVLCVVAKQALK 493
            :.:...|:.:|.:.|..:.||....::.|       |:|||
 Worm   476 QFQRNFVNVLDRVPEAKQALEERFMTADE-------KKALK 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 15/48 (31%)
set-30NP_508850.2 zf-MYND 41..78 CDD:280009 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.