DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-3 and set-18

Sequence 1:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_871849.1 Gene:set-18 WormBaseID:WBGene00044070 Length:507 Species:Caenorhabditis elegans

Alignment Length:523 Identity:117/524 (22%)
Similarity:196/524 (37%) Gaps:129/524 (25%)


  Fly    24 LVAKGAIRG-HG-LLIEELPFA---VGPKCNGPVVCLGCYEPNPDPEEEL--CSECGWPL-C-VE 79
            ||.|..|.. |. :.|.|.|||   :.||.:  ..|..|.. .|.|.|:|  |..|.:.: | .|
 Worm    16 LVQKDEISSIHARIKIFETPFATQVLNPKVS--EFCANCLR-GPAPGEKLLRCGGCNFSMYCSKE 77

  Fly    80 CAQQADNAHFRLECSQLKDARARFFRLPSGSRHCPQLDCIMPLRVLLAK----EANPERWDNEV- 139
            |...|...| :.||.:||   |.|..||        |..::.|..::.:    |.|.::...|. 
 Worm    78 CQATAWLVH-KPECKRLK---ASFPNLP--------LTEVLFLSKVIDRIQFLEKNGDKLGIEAE 130

  Fly   140 ----APMEHHKEERQRDADVWHADRV--NIAQYLRGPCQLANRFSEELI-----MQVVGVLEVNA 193
                :.::|..:.|..:..:.|.:::  .:..: ||         ||:|     ..|.....:|:
 Worm   131 RKFSSLVDHKVDIRDDEEKMAHFEKIFEKMGAF-RG---------EEMIEKGEFFDVFCKATINS 185

  Fly   194 FEARSPKGYPLRCLFPYTGI--LAHNCVPNTSRSIYPSEGYKIRLRAM---VDLEEGQPLHHSYT 253
            ....:..|..:..... .|:  ..|:|.|..|...   :||::.||.:   ||.|..:....||.
 Worm   186 HSIHTNAGNEVGMALD-LGVSKYNHSCRPTCSMVF---DGYRVCLRPLVPGVDAENTEEAFISYI 246

  Fly   254 YTLDGTAQRQKHLKQGKFFTCQCERCLDPTELGTHFSSLKCGQCAEGFQVPRQPTEPDTSWNCAN 318
            ........|::.|....:|.|:|.||:||.:  ...::::|...|....:....||...:..|..
 Worm   247 DVGRSKYIRRRDLNSRWYFNCECTRCMDPED--DALTAIRCANPACDAPILTSETEEPMNIACEK 309

  Fly   319 CGS----DTSNADALAMLQSLQSEVN-----AVQALPMAAKRLEEIERLLRKYKSLLHPLHFIAT 374
            |.:    ||..| |...:::|.:..:     .::|||      .:::.||.|.:.:|||.:....
 Worm   310 CKTIVEEDTVKA-AQEYMKTLPASFDPKCPAEIEALP------GKLKELLAKAEQILHPSNVYVA 367

  Fly   375 GLRQLLIEMYG--------------------------RVQGYEMVQLPDHQLER--KAELCRQVL 411
            .||..|..:.|                          |..|::::.:....:|:  :.|......
 Worm   368 RLRTALFHVTGTLTMDNLSSMHTQIYNNYKMCFPKADRHVGFQLLHIVKALIEKDERDEAMPYAF 432

  Fly   412 RVLNTFE-------PGLSRTRAMNLY-ELHVP-----LVLLAKSGFIAGKLKGGELRARLVDAID 463
            ..:|.||       |...:|.|:..| |..:|     ||.|....           ..|.:|.:.
 Worm   433 DAMNIFEVCFGLDHPYYLQTLALWTYLEKKIPKSTEELVQLTNFS-----------DNRPIDIVS 486

  Fly   464 LLK 466
            |||
 Worm   487 LLK 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 13/50 (26%)
set-18NP_871849.1 zf-MYND 49..90 CDD:280009 14/43 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.626 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.