DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-3 and smyd2

Sequence 1:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_002934751.2 Gene:smyd2 XenbaseID:XB-GENE-985583 Length:430 Species:Xenopus tropicalis

Alignment Length:294 Identity:65/295 (22%)
Similarity:102/295 (35%) Gaps:72/295 (24%)


  Fly    31 RGHGLLIEELPFAVGP---KCNGPVV------------CLGCYEPNPDPEEELCSECGWPLC--- 77
            :|.||.... |||:|.   .|  |..            |..|:     ..:|..|:||  .|   
 Frog    15 KGRGLKATR-PFALGELLFSC--PAYTYVLTVNERGNHCEFCF-----ARKEGLSKCG--KCKQA 69

  Fly    78 ----VECAQQADNAHFRLECSQLKDARARFFRLPSGSRHCPQLDCIMPLRVLLAKEANPERWDNE 138
                |:| |:.|....:||||.:         ...|...||.....:..|:|..::...||..:|
 Frog    70 FYCNVDC-QKGDWPMHKLECSAM---------CTYGQNWCPSETVRLTARILAKQKTQTERTASE 124

  Fly   139 ----VAPMEHHKEERQRDADVWHADRVNIAQYLRGPCQLANRFSEELIMQVVGVLEVNAFEARSP 199
                |...|.|..:...:.          .:.::......:||..:.:.......:|..|...:.
 Frog   125 RFLSVKDFESHLSKLDNEK----------LELIQNDIAALHRFYSKNLHYSDNAAQVFLFAQVNC 179

  Fly   200 KGYPLR---------CLFPYTGILAHNCVPNTSRSIYPSEGYKIRLRAMVDLEEGQPLHHSYTYT 255
            .|:.:.         .:||...::.|:|.||.   |...:|....:||:.::..|..:..||...
 Frog   180 NGFTIEDEELSHLGSAIFPDVALMNHSCCPNV---IVTYKGTVAEVRAVQEIHAGDEVFTSYIDL 241

  Fly   256 LDGTAQRQKHLKQGKFFTCQCERC----LDPTEL 285
            |..|..|...|....||.|.|..|    .||.:|
 Frog   242 LYPTEDRNDRLIDSYFFNCDCRECSTKQKDPAKL 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 12/45 (27%)
smyd2XP_002934751.2 zf-MYND 50..88 CDD:280009 13/46 (28%)
SET 145..238 CDD:279228 17/96 (18%)
TPR_12 336..409 CDD:290160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.