DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and OLI1

DIOPT Version :8

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_009319.1 Gene:OLI1 / 854584 SGDID:S000007274 Length:76 Species:Saccharomyces cerevisiae

Alignment Length:79 Identity:22/80 (28%)
Similarity:37/80 (46%) Gaps:11/80 (14%)


  Fly   112 ELAPAPKYSLPTGYVHLAAGLS-VGFAGLAAGYAVGEVGEV-GV-RHIALQPRLFIGMILILIFA 173
            :|..|.||        :.||:| :|..|...|.|:.....: || |:.:::..:|...||....:
Yeast     2 QLVLAAKY--------IGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALS 58

  Fly   174 EVLGLYGLIIGIYL 187
            |..||:.|::...|
Yeast    59 EATGLFCLMVSFLL 72

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 12/43 (28%)
ATP-synt_C 127..187 CDD:278563 17/63 (27%)
OLI1NP_009319.1 ATP-synt_C 2..76 CDD:320987 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.