DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and AVA-P2

DIOPT Version :8

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_564098.2 Gene:AVA-P2 / 838579 AraportID:AT1G19910 Length:165 Species:Arabidopsis thaliana

Alignment Length:145 Identity:86/146 (59%)
Similarity:111/146 (76%) Gaps:1/146 (1%)


  Fly    44 SPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVVSVL 108
            :||:|.:|...:.|.:..|||||||.||.|:|:..|||||||||||:||||||::.||||:::|:
plant    11 APFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVI 75

  Fly   109 LSGELAP-APKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGMILILIF 172
            :|..:.| |..|.|..||.||::||:.|.|||:||.|:|.||:.|||..|.||:||:||||||||
plant    76 ISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIF 140

  Fly   173 AEVLGLYGLIIGIYL 187
            ||.|.|||||:||.|
plant   141 AEALALYGLIVGIIL 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 59/108 (55%)
ATP-synt_C 127..187 CDD:278563 40/60 (67%)
AVA-P2NP_564098.2 V_ATP_synt_C 13..121 CDD:130170 59/108 (55%)
ATP-synt_C 96..155 CDD:306615 39/59 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H113185
Inparanoid 1 1.050 200 1.000 Inparanoid score I1277
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1534092at2759
OrthoInspector 1 1.000 T32315
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10263
Phylome 1 0.910 0.707 Consistency score
66.070

Return to query results.
Submit another query.