DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and atp6v0cb

DIOPT Version :8

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_991117.1 Gene:atp6v0cb / 325402 ZFINID:ZDB-GENE-030131-4127 Length:153 Species:Danio rerio

Alignment Length:149 Identity:99/150 (66%)
Similarity:120/150 (80%) Gaps:2/150 (1%)


  Fly    41 PPYSPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVV 105
            |.||||:.|||...:.|.::.|||||||.|||||||.:||||||:||||||||||||||||||||
Zfish     6 PEYSPFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVV 70

  Fly   106 SVLLSGELAPAPKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGMILIL 170
            :||::..:  :.|.:|...::||.||||||.:|||||:|:|.||:.|||..|.|||||:||||||
Zfish    71 AVLIANSI--SDKITLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILIL 133

  Fly   171 IFAEVLGLYGLIIGIYLYT 189
            ||||||||||||:.:.|.|
Zfish   134 IFAEVLGLYGLIVALILST 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 67/107 (63%)
ATP-synt_C 127..187 CDD:278563 44/60 (73%)
atp6v0cbNP_991117.1 V_ATP_synt_C 11..116 CDD:130170 67/107 (63%)
ATP-synt_C 90..151 CDD:278563 45/61 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C251478063
eggNOG 1 0.900 E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1534092at2759
OrthoFinder 1 1.000 FOG0001016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10263
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.