DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and Vha16-3

DIOPT Version :9

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster


Alignment Length:149 Identity:108/149 - (72%)
Similarity:126/149 - (84%) Gaps:2/149 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PPYSPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVV 105
            |.||.|:|.||...:.:.::.|||||||.|||||||.|||||||:||||||||||||||||||||
  Fly    11 PAYSFFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMAGIIAIYGLVV 75

  Fly   106 SVLLSGELAPAPKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGMILIL 170
            |||::|.|:.:  |::..||:||||||||||||||||:|:|.||:.|||..|.|||||:||||||
  Fly    76 SVLIAGSLSDS--YTIRKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILIL 138

  Fly   171 IFAEVLGLYGLIIGIYLYT 189
            ||||||||||||:.|||||
  Fly   139 IFAEVLGLYGLIVAIYLYT 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 73/106 (69%)
ATP-synt_C 127..187 CDD:278563 48/59 (81%)
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 73/106 (69%)
ATP-synt_Vo_c_ATP6C_rpt2 91..156 CDD:349416 51/64 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444254
Domainoid 1 1.000 89 1.000 Domainoid score I2684
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1314
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm8409
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
1110.850

Return to query results.
Submit another query.