DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-5 and Vha16-3

DIOPT Version :8

Sequence 1:NP_609447.1 Gene:Vha16-5 / 34482 FlyBaseID:FBgn0032294 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster

Alignment Length:149 Identity:108/150 (72%)
Similarity:126/150 (84%) Gaps:2/150 (1%)


  Fly    41 PPYSPFYGVMGVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAIYGLVV 105
            |.||.|:|.||...:.:.::.|||||||.|||||||.|||||||:||||||||||||||||||||
  Fly    11 PAYSFFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMAGIIAIYGLVV 75

  Fly   106 SVLLSGELAPAPKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGEVGVRHIALQPRLFIGMILIL 170
            |||::|.|:.:  |::..||:||||||||||||||||:|:|.||:.|||..|.|||||:||||||
  Fly    76 SVLIAGSLSDS--YTIRKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILIL 138

  Fly   171 IFAEVLGLYGLIIGIYLYT 189
            ||||||||||||:.|||||
  Fly   139 IFAEVLGLYGLIVAIYLYT 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-5NP_609447.1 ATP-synt_C 46..153 CDD:294318 74/107 (69%)
ATP-synt_C 127..187 CDD:278563 49/60 (82%)
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 74/107 (69%)
ATP-synt_C 95..155 CDD:278563 49/60 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C250793154
eggNOG 1 0.900 E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1277
Isobase 1 0.950 0 Normalized mean entropy S170
OrthoDB 1 1.010 D1534092at2759
OrthoFinder 1 1.000 FOG0001016
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10263
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.