DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD200R1L and sns

DIOPT Version :10

Sequence 1:NP_001008784.2 Gene:CD200R1L / 344807 HGNCID:24665 Length:271 Species:Homo sapiens
Sequence 2:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster


Alignment Length:177 Identity:39/177 - (22%)
Similarity:64/177 - (36%) Gaps:32/177 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    65 ITWEIILRGQPSCTKAYKKETNETKETNCTVERITWVSRPDQNSDLQIRP-VDTTHDGY---YRG 125
            |.|   .||...    ||.|..|......|.:|.|      ..|.|:::| .|..:..|   .|.
  Fly   211 IVW---YRGNVE----YKPEKREDTVEESTAKRFT------TTSSLKLKPGPDDDYTEYTCQARH 262

Human   126 IVVTPDGNFHRGYHLQVLVTP----------EVNLFQSRNITAVCKAVTGKPAAQISWIPEGSIL 180
            ..::||........|.||..|          ...|.:.:.:..:|::..|.|.||:.|...||.:
  Fly   263 KALSPDMPMRATVQLSV
LYPPGPPYIEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYKNGSQI 327

Human   181 ATKQEYWGNGTVT---VKSTCPWEGHKSTVTCHVSHLTGNKSLSVKL 224
              :..|..:|.::   ...|.....:|:...|..|::.....|..::
  Fly   328 --RMAYRTSGRLSENIYTFTAEAGDNKARFRCEASNVMSQNPLKAEV 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD200R1LNP_001008784.2 Ig 37..143 CDD:472250 20/81 (25%)
Ig strand B 50..54 CDD:409353
Ig strand C 64..68 CDD:409353 1/2 (50%)
Ig strand E 108..112 CDD:409353 2/3 (67%)
Ig strand F 122..127 CDD:409353 2/7 (29%)
Ig strand G 135..138 CDD:409353 0/2 (0%)
Ig 147..224 CDD:472250 16/79 (20%)
Ig strand B 156..160 CDD:409500 0/3 (0%)
Ig strand C 170..174 CDD:409500 1/3 (33%)
Ig strand F 206..211 CDD:409500 1/4 (25%)
Ig strand G 219..222 CDD:409500 1/2 (50%)
snsNP_001036532.1 Ig 73..170 CDD:472250
Ig strand B 89..93 CDD:409559
Ig strand C 101..105 CDD:409559
Ig strand E 130..138 CDD:409559
Ig strand F 148..153 CDD:409559
Ig 173..279 CDD:472250 20/80 (25%)
Ig strand B 196..200 CDD:409418
Ig strand C 210..214 CDD:409418 2/5 (40%)
Ig strand E 241..245 CDD:409418 2/3 (67%)
Ig strand F 255..260 CDD:409418 1/4 (25%)
Ig strand G 272..275 CDD:409418 0/2 (0%)
Ig_3 285..361 CDD:464046 14/77 (18%)
Ig 377..>457 CDD:472250
Ig strand B 397..401 CDD:409418
Ig strand C 411..415 CDD:409418
Ig strand E 440..444 CDD:409418
Ig 477..560 CDD:472250
Ig strand B 499..504 CDD:409418
Ig strand C 514..518 CDD:409418
Ig strand E 537..541 CDD:409418
Ig strand F 551..556 CDD:409418
Ig 584..666 CDD:472250
Ig strand B 595..599 CDD:409416
Ig strand C 609..613 CDD:409416
Ig strand E 636..642 CDD:409416
Ig strand F 652..657 CDD:409416
Ig strand G 667..670 CDD:409416
Ig 678..767 CDD:472250
Ig strand B 696..700 CDD:409353
Ig strand C 710..714 CDD:409353
Ig strand E 733..737 CDD:409353
Ig strand F 747..752 CDD:409353
Ig_3 772..847 CDD:464046
Ig 881..963 CDD:472250
Ig strand B 885..888 CDD:409353
Ig strand C 897..901 CDD:409353
Ig strand E 929..933 CDD:409353
Ig strand F 943..948 CDD:409353
FN3 967..1051 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.