DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD200R1L and nrm

DIOPT Version :10

Sequence 1:NP_001008784.2 Gene:CD200R1L / 344807 HGNCID:24665 Length:271 Species:Homo sapiens
Sequence 2:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster


Alignment Length:274 Identity:61/274 - (22%)
Similarity:96/274 - (35%) Gaps:76/274 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    16 ASSSSCMGGKQMTQNYS-TIFAEGNISQPVLMDIN-----------AVLCCPPIALRNLIIITW- 67
            |....|.......||.: |.|:.....:|..:|||           .||.|.....|..:.:|| 
  Fly   237 AQDIECRVKSAAIQNVTVTKFSVDLQVRPTSIDINGVKHHTVQGSKVVLTCDIHGARPAVNLTWY 301

Human    68 ---EIILRGQPSCTKAYKKETNETKETNCTVERITW---------VSRPD-QNSDLQI---RPVD 116
               .||..|:...|:...|...::..|..|...:.:         |.|.: :|..|||   :|:.
  Fly   302 NTTTIISSGENEITEVRSKSLEKSDGTFHTQSELIFNATRFENDRVFRCEAENIVLQINREKPIS 366

Human   117 TTHDGYYRGIVVTPDGNFHRGYHLQVLVTPEVNLFQSRNITAVCKAVT-------GKPAA--QIS 172
            :                   ...|:||..|.|.:..|. |||....:.       ..||:  |:.
  Fly   367 S-------------------ALTLEVLYPPVVKVSPSA-ITANTSEIVLLNCEYFANPASLTQVE 411

Human   173 WIPEGSILATKQE---YWG----NGTVTVKSTCPWEGHKSTV---TCHVSHLTGNKSLSVKLNSG 227
            |. ...||....:   |.|    |..:.:|||     .|..:   :|.:|:..|..:...|:|  
  Fly   412 WY-RNDILVNVNDTTHYKGGNSENVALVIKST-----EKEDIGNYSCQLSNNIGKGTSDQKIN-- 468

Human   228 LRTSGSPALSLLII 241
            |....:|.:.:|:|
  Fly   469 LDVQYAPTVEILMI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD200R1LNP_001008784.2 Ig 37..143 CDD:472250 25/133 (19%)
Ig strand B 50..54 CDD:409353 2/3 (67%)
Ig strand C 64..68 CDD:409353 2/7 (29%)
Ig strand E 108..112 CDD:409353 1/3 (33%)
Ig strand F 122..127 CDD:409353 0/4 (0%)
Ig strand G 135..138 CDD:409353 0/2 (0%)
Ig 147..224 CDD:472250 21/95 (22%)
Ig strand B 156..160 CDD:409500 3/3 (100%)
Ig strand C 170..174 CDD:409500 1/3 (33%)
Ig strand F 206..211 CDD:409500 1/7 (14%)
Ig strand G 219..222 CDD:409500 0/2 (0%)
nrmNP_001246890.1 V-set 44..152 CDD:462230
Ig strand B 183..187 CDD:409353
Ig <185..248 CDD:472250 2/10 (20%)
Ig strand C 197..201 CDD:409353
Ig strand E 225..229 CDD:409353
Ig strand F 239..244 CDD:409353 1/4 (25%)
Ig strand G 253..256 CDD:409353 0/2 (0%)
Ig 277..354 CDD:472250 15/76 (20%)
Ig strand B 283..287 CDD:409353 2/3 (67%)
Ig strand C 297..301 CDD:409353 1/3 (33%)
Ig strand E 333..337 CDD:409353 0/3 (0%)
Ig strand F 347..352 CDD:409353 2/4 (50%)
Ig_3 376..456 CDD:464046 20/86 (23%)
Ig 676..779 CDD:472250
Ig strand B 689..693 CDD:409353
Ig strand C 702..706 CDD:409353
Ig strand E 734..741 CDD:409353
Ig strand F 762..767 CDD:409353
Ig <811..869 CDD:472250
Ig strand C 820..824 CDD:143205
Ig strand F 849..854 CDD:143205
Ig strand G 862..865 CDD:143205
PTZ00112 1747..>1940 CDD:240274
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.